Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0WML9

Protein Details
Accession A0A2K0WML9    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-48MVAAKHVKIVKKRTKRFERHQSDRFKCVDPSWRKPKGIDSRVRRRFRGBasic
NLS Segment(s)
PositionSequence
10-16VKKRTKR
34-44KPKGIDSRVRR
Subcellular Location(s) mito 17.5, mito_nucl 12.333, nucl 6, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKHVKIVKKRTKRFERHQSDRFKCVDPSWRKPKGIDSRVRRRFRGTIAMPSIGYGSNKKTRYMTPSGHKAFLVCNVNDVELLLMHNRTHAAEIAHNVSSRKRVDIIARAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.91
4 0.91
5 0.91
6 0.9
7 0.89
8 0.89
9 0.84
10 0.8
11 0.73
12 0.64
13 0.56
14 0.5
15 0.52
16 0.49
17 0.54
18 0.57
19 0.61
20 0.59
21 0.59
22 0.64
23 0.65
24 0.65
25 0.65
26 0.65
27 0.69
28 0.77
29 0.81
30 0.73
31 0.68
32 0.63
33 0.57
34 0.57
35 0.48
36 0.46
37 0.43
38 0.42
39 0.36
40 0.33
41 0.29
42 0.2
43 0.18
44 0.12
45 0.13
46 0.19
47 0.2
48 0.21
49 0.23
50 0.24
51 0.29
52 0.34
53 0.35
54 0.34
55 0.42
56 0.43
57 0.42
58 0.39
59 0.34
60 0.29
61 0.3
62 0.28
63 0.18
64 0.18
65 0.17
66 0.17
67 0.17
68 0.16
69 0.1
70 0.06
71 0.07
72 0.06
73 0.07
74 0.06
75 0.07
76 0.08
77 0.08
78 0.09
79 0.1
80 0.1
81 0.11
82 0.14
83 0.16
84 0.17
85 0.18
86 0.18
87 0.18
88 0.23
89 0.23
90 0.22
91 0.21
92 0.23
93 0.28
94 0.36
95 0.43
96 0.46
97 0.49
98 0.48
99 0.46
100 0.45
101 0.42
102 0.38
103 0.33
104 0.3
105 0.35
106 0.43
107 0.5
108 0.49
109 0.5
110 0.47