Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0WFC9

Protein Details
Accession A0A2K0WFC9    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MATTTTVRKDHKKWKCNKNISGKLCGTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MATTTTVRKDHKKWKCNKNISGKLCGTVTSMSNIYCDKCDKRRQTDDEALASDDSSIGRLYHLDLNLTEHWEYTSPEPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.88
4 0.88
5 0.89
6 0.88
7 0.83
8 0.8
9 0.7
10 0.61
11 0.51
12 0.42
13 0.33
14 0.24
15 0.2
16 0.14
17 0.14
18 0.12
19 0.12
20 0.13
21 0.12
22 0.12
23 0.15
24 0.16
25 0.22
26 0.31
27 0.37
28 0.44
29 0.52
30 0.56
31 0.6
32 0.63
33 0.6
34 0.53
35 0.47
36 0.4
37 0.32
38 0.27
39 0.18
40 0.11
41 0.08
42 0.07
43 0.06
44 0.05
45 0.05
46 0.06
47 0.09
48 0.12
49 0.13
50 0.14
51 0.14
52 0.18
53 0.19
54 0.22
55 0.2
56 0.16
57 0.17
58 0.17
59 0.19