Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2K0W9C7

Protein Details
Accession A0A2K0W9C7    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
78-103VSGGSSELRRRKRRRNGSSSRTRPPSHydrophilic
NLS Segment(s)
PositionSequence
86-100RRRKRRRNGSSSRTR
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MTNPNFVNPITFQQQKGTDQAWVKRALEAFPNADSLRTIEGPWDREIPRIRDDELTPASEIQSGASSVSSLSDTSIVVSGGSSELRRRKRRRNGSSSRTRPPSASSPAPSSSVPWTSRSARHHLPHRPWAIRAPQPQVLTANNTSAPNPRIRIRAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.39
4 0.34
5 0.34
6 0.36
7 0.4
8 0.39
9 0.4
10 0.38
11 0.37
12 0.37
13 0.32
14 0.3
15 0.28
16 0.26
17 0.22
18 0.25
19 0.21
20 0.21
21 0.19
22 0.16
23 0.16
24 0.14
25 0.14
26 0.15
27 0.18
28 0.2
29 0.22
30 0.26
31 0.23
32 0.28
33 0.33
34 0.33
35 0.33
36 0.33
37 0.33
38 0.3
39 0.31
40 0.31
41 0.27
42 0.25
43 0.21
44 0.19
45 0.18
46 0.16
47 0.15
48 0.09
49 0.08
50 0.07
51 0.06
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.04
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.05
70 0.09
71 0.16
72 0.25
73 0.35
74 0.43
75 0.54
76 0.64
77 0.75
78 0.81
79 0.85
80 0.87
81 0.87
82 0.9
83 0.87
84 0.85
85 0.79
86 0.7
87 0.6
88 0.54
89 0.5
90 0.45
91 0.43
92 0.38
93 0.36
94 0.36
95 0.37
96 0.33
97 0.29
98 0.26
99 0.26
100 0.25
101 0.23
102 0.27
103 0.28
104 0.35
105 0.37
106 0.41
107 0.43
108 0.5
109 0.56
110 0.61
111 0.65
112 0.68
113 0.72
114 0.67
115 0.62
116 0.61
117 0.6
118 0.59
119 0.58
120 0.55
121 0.52
122 0.5
123 0.5
124 0.46
125 0.4
126 0.38
127 0.33
128 0.3
129 0.27
130 0.27
131 0.26
132 0.29
133 0.3
134 0.3
135 0.33
136 0.35