Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0UE40

Protein Details
Accession A0A2K0UE40    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
122-142KETPFKWPSNRWPKEKRFKDLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 10, mito 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
Pfam View protein in Pfam  
PF13489  Methyltransf_23  
Amino Acid Sequences MDNYSNLSSVPPNVKFEIDDIDEEWTYSLPFDYIHSRMMNVSVKNWPEYLRKIFENLTPGGYAELQDVDVMMQSDDNTLTQDHALWKWGDFLAKAGQEHGTPFIETKRLKHLMTEVGFVDVKETPFKWPSNRWPKEKRFKDLGEWSNLNTIDLLNGLSMALFTRCLGWTPEEVNVFLVDVRKDLNNPKIHAYWSIRSVYGRKPEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.29
4 0.3
5 0.24
6 0.23
7 0.19
8 0.21
9 0.2
10 0.2
11 0.19
12 0.13
13 0.11
14 0.1
15 0.09
16 0.06
17 0.06
18 0.09
19 0.13
20 0.14
21 0.18
22 0.18
23 0.19
24 0.19
25 0.23
26 0.26
27 0.22
28 0.23
29 0.25
30 0.27
31 0.28
32 0.28
33 0.27
34 0.27
35 0.32
36 0.35
37 0.33
38 0.33
39 0.34
40 0.35
41 0.34
42 0.33
43 0.28
44 0.23
45 0.19
46 0.18
47 0.17
48 0.15
49 0.12
50 0.09
51 0.08
52 0.07
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.08
70 0.08
71 0.11
72 0.1
73 0.1
74 0.11
75 0.11
76 0.11
77 0.09
78 0.1
79 0.11
80 0.12
81 0.12
82 0.11
83 0.11
84 0.11
85 0.11
86 0.12
87 0.09
88 0.08
89 0.09
90 0.09
91 0.14
92 0.14
93 0.15
94 0.21
95 0.24
96 0.24
97 0.24
98 0.26
99 0.27
100 0.28
101 0.28
102 0.2
103 0.19
104 0.19
105 0.18
106 0.17
107 0.11
108 0.11
109 0.11
110 0.11
111 0.12
112 0.16
113 0.18
114 0.21
115 0.26
116 0.36
117 0.46
118 0.52
119 0.58
120 0.65
121 0.73
122 0.8
123 0.81
124 0.78
125 0.75
126 0.7
127 0.7
128 0.69
129 0.64
130 0.6
131 0.53
132 0.47
133 0.44
134 0.41
135 0.33
136 0.23
137 0.18
138 0.11
139 0.1
140 0.1
141 0.05
142 0.05
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.07
151 0.07
152 0.09
153 0.11
154 0.13
155 0.15
156 0.17
157 0.21
158 0.21
159 0.21
160 0.2
161 0.18
162 0.16
163 0.15
164 0.15
165 0.11
166 0.11
167 0.12
168 0.13
169 0.16
170 0.23
171 0.3
172 0.34
173 0.37
174 0.42
175 0.42
176 0.43
177 0.47
178 0.47
179 0.43
180 0.41
181 0.42
182 0.38
183 0.39
184 0.41
185 0.42