Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0VYM4

Protein Details
Accession A0A2K0VYM4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MEDSRPTKRARQACEPCRRKKSKCPGEKPVCSYCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MEDSRPTKRARQACEPCRRKKSKCPGEKPVCSYCERLGQICVYESGSDSQGQRARSDRSLELRMETLEEKLDLFIDRLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.83
4 0.86
5 0.88
6 0.84
7 0.84
8 0.85
9 0.84
10 0.86
11 0.85
12 0.85
13 0.86
14 0.85
15 0.81
16 0.75
17 0.68
18 0.59
19 0.52
20 0.43
21 0.4
22 0.34
23 0.29
24 0.24
25 0.21
26 0.19
27 0.17
28 0.16
29 0.09
30 0.08
31 0.08
32 0.08
33 0.09
34 0.1
35 0.1
36 0.14
37 0.17
38 0.18
39 0.19
40 0.22
41 0.25
42 0.27
43 0.31
44 0.3
45 0.33
46 0.36
47 0.35
48 0.34
49 0.31
50 0.28
51 0.26
52 0.23
53 0.18
54 0.15
55 0.15
56 0.13
57 0.12
58 0.13
59 0.11