Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7RP09

Protein Details
Accession J7RP09    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-39LKQNSKKREEKLKLINRVRNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8cyto_nucl 8E.R. 8, cyto 6, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003892  CUE  
Gene Ontology GO:0016020  C:membrane  
GO:0043130  F:ubiquitin binding  
Pfam View protein in Pfam  
PF02845  CUE  
PROSITE View protein in PROSITE  
PS51140  CUE  
CDD cd14424  CUE_Cue1p_like  
Amino Acid Sequences MDNSTIVLIGILILGYLLTLKQNSKKREEKLKLINRVRNLKAEENEMLATPKTDTKETPQNLNPEGVTDGEEKPDLDEIEDKKPFTKREVTQDMIEVVQTLAPNLDVEQIRASLQKTGSIEKTVTYYLAGEEFPSADE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.03
4 0.03
5 0.05
6 0.07
7 0.11
8 0.19
9 0.27
10 0.33
11 0.42
12 0.5
13 0.56
14 0.66
15 0.69
16 0.71
17 0.74
18 0.78
19 0.8
20 0.8
21 0.78
22 0.75
23 0.76
24 0.69
25 0.64
26 0.6
27 0.55
28 0.48
29 0.47
30 0.4
31 0.33
32 0.31
33 0.25
34 0.21
35 0.15
36 0.13
37 0.1
38 0.12
39 0.12
40 0.13
41 0.13
42 0.17
43 0.26
44 0.27
45 0.32
46 0.34
47 0.36
48 0.35
49 0.35
50 0.3
51 0.22
52 0.21
53 0.15
54 0.13
55 0.11
56 0.1
57 0.1
58 0.1
59 0.09
60 0.09
61 0.1
62 0.08
63 0.07
64 0.11
65 0.12
66 0.18
67 0.2
68 0.2
69 0.21
70 0.25
71 0.26
72 0.27
73 0.32
74 0.3
75 0.38
76 0.45
77 0.45
78 0.42
79 0.41
80 0.38
81 0.3
82 0.26
83 0.17
84 0.1
85 0.09
86 0.08
87 0.06
88 0.05
89 0.06
90 0.06
91 0.06
92 0.11
93 0.1
94 0.11
95 0.12
96 0.12
97 0.13
98 0.15
99 0.16
100 0.15
101 0.15
102 0.19
103 0.2
104 0.24
105 0.26
106 0.27
107 0.26
108 0.23
109 0.25
110 0.22
111 0.2
112 0.16
113 0.14
114 0.12
115 0.13
116 0.12
117 0.1
118 0.1