Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2K0WLW0

Protein Details
Accession A0A2K0WLW0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-84HSSVKKRCEHCKVVRRKAGKRHNGYLBasic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASFLRAFALSARLLTPSNAMGAFVARANWSLFASPSTTPISRVLGNGLMQQTRGMKVHSSVKKRCEHCKVVRRKAGKRHNGYLYIICKANPRHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.11
5 0.12
6 0.11
7 0.11
8 0.09
9 0.09
10 0.09
11 0.08
12 0.08
13 0.07
14 0.08
15 0.08
16 0.09
17 0.09
18 0.09
19 0.09
20 0.09
21 0.11
22 0.1
23 0.12
24 0.15
25 0.14
26 0.15
27 0.17
28 0.18
29 0.16
30 0.16
31 0.15
32 0.13
33 0.13
34 0.14
35 0.13
36 0.11
37 0.11
38 0.11
39 0.11
40 0.11
41 0.11
42 0.1
43 0.09
44 0.12
45 0.21
46 0.27
47 0.35
48 0.39
49 0.46
50 0.53
51 0.57
52 0.63
53 0.62
54 0.65
55 0.67
56 0.72
57 0.75
58 0.78
59 0.81
60 0.81
61 0.81
62 0.82
63 0.83
64 0.83
65 0.8
66 0.79
67 0.77
68 0.72
69 0.67
70 0.64
71 0.57
72 0.5
73 0.43
74 0.35
75 0.35
76 0.39
77 0.45
78 0.48
79 0.54