Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0UQ70

Protein Details
Accession A0A2K0UQ70    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
76-108ELMESFRKKHPKQFNNKGLRRSGQTKRIPKKISHydrophilic
NLS Segment(s)
PositionSequence
82-106RKKHPKQFNNKGLRRSGQTKRIPKK
Subcellular Location(s) nucl 13, cyto 11, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR023780  Chromo_domain  
Gene Ontology GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF00385  Chromo  
CDD cd00024  CD_CSD  
Amino Acid Sequences MKHLLPAYADDFVDEQPGPVEGEPIDENRYKVNFIIKRQVRRLRRNATPFKGFLIRWKGWGPEHDQWVKTADISEELMESFRKKHPKQFNNKGLRRSGQTKRIPKKISETD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.1
4 0.11
5 0.11
6 0.09
7 0.1
8 0.07
9 0.11
10 0.11
11 0.13
12 0.16
13 0.16
14 0.17
15 0.19
16 0.2
17 0.18
18 0.18
19 0.26
20 0.27
21 0.29
22 0.39
23 0.42
24 0.48
25 0.56
26 0.64
27 0.65
28 0.7
29 0.76
30 0.73
31 0.75
32 0.78
33 0.77
34 0.74
35 0.68
36 0.59
37 0.52
38 0.48
39 0.4
40 0.36
41 0.35
42 0.29
43 0.28
44 0.28
45 0.28
46 0.25
47 0.28
48 0.28
49 0.25
50 0.31
51 0.31
52 0.3
53 0.29
54 0.3
55 0.28
56 0.21
57 0.17
58 0.12
59 0.1
60 0.1
61 0.1
62 0.08
63 0.08
64 0.08
65 0.09
66 0.09
67 0.11
68 0.16
69 0.26
70 0.28
71 0.38
72 0.48
73 0.58
74 0.68
75 0.77
76 0.81
77 0.83
78 0.87
79 0.84
80 0.79
81 0.74
82 0.7
83 0.67
84 0.66
85 0.65
86 0.69
87 0.73
88 0.76
89 0.81
90 0.78
91 0.75