Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2K0W7N4

Protein Details
Accession A0A2K0W7N4    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
49-72LREKLRCKLKQLRESMRHRIKRRRBasic
NLS Segment(s)
PositionSequence
60-72LRESMRHRIKRRR
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MKYYQPIDPEDQESEADNIFEEYLERFCLNMEYHTDNFKAACREVRDELREKLRCKLKQLRESMRHRIKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.19
3 0.15
4 0.11
5 0.1
6 0.08
7 0.08
8 0.06
9 0.06
10 0.07
11 0.08
12 0.08
13 0.07
14 0.08
15 0.1
16 0.1
17 0.1
18 0.13
19 0.16
20 0.17
21 0.19
22 0.19
23 0.17
24 0.16
25 0.17
26 0.15
27 0.12
28 0.16
29 0.17
30 0.2
31 0.24
32 0.29
33 0.32
34 0.34
35 0.38
36 0.44
37 0.47
38 0.45
39 0.49
40 0.54
41 0.52
42 0.57
43 0.63
44 0.64
45 0.67
46 0.75
47 0.77
48 0.78
49 0.82
50 0.84
51 0.85
52 0.84