Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2K0WBA9

Protein Details
Accession A0A2K0WBA9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAPSYHRRHSNQSRGRSRTPQTHydrophilic
95-116QSTSIARRRNRSNYRDNRNSAVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 10.5, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MAPSYHRRHSNQSRGRSRTPQTQPAVPENQSRADAQRAAAEAKEVARQHQREASRLQTIAESFSAEGSAGASEASGSHASQASGRADGPRSNSRQSTSIARRRNRSNYRDNRNSAVVKTPVLRRRVTEVARLDKTNRDGTTTMEVVNTSLSGGITTNFEATTHSGGALGRTTRVAAITASAHQVQKETGARELCYQIEPVLDNRQRFIDANIMSVRTTANHGRVRHGQVAAFQQRQVADISDQPDTRRCVNCDSTSHSLKDCLRAYKGYIFACILCDKRDHLTDRCHQFASLNFKEKFKLLVLDRANKPPLGVKDEALEWWIVLSDFVDSDQHSPEEQFVGFPWSPKYAEDVTWEDGGEYAIGLQREYEVAFDASLLPVQFSPNDIQSVWDRFWPRSPSRNDGHHSPDDSAQASSSNVSSTQTNEGGPNAGVELFPAAALRRSREMRNRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.84
4 0.8
5 0.79
6 0.79
7 0.77
8 0.72
9 0.7
10 0.68
11 0.66
12 0.67
13 0.59
14 0.57
15 0.51
16 0.49
17 0.45
18 0.42
19 0.37
20 0.36
21 0.35
22 0.28
23 0.29
24 0.28
25 0.27
26 0.25
27 0.23
28 0.19
29 0.19
30 0.24
31 0.2
32 0.24
33 0.32
34 0.34
35 0.37
36 0.42
37 0.44
38 0.43
39 0.47
40 0.47
41 0.43
42 0.42
43 0.38
44 0.34
45 0.32
46 0.3
47 0.25
48 0.2
49 0.14
50 0.14
51 0.13
52 0.1
53 0.09
54 0.07
55 0.06
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.07
62 0.07
63 0.07
64 0.09
65 0.1
66 0.11
67 0.12
68 0.16
69 0.15
70 0.15
71 0.16
72 0.18
73 0.2
74 0.22
75 0.27
76 0.32
77 0.35
78 0.39
79 0.41
80 0.41
81 0.41
82 0.41
83 0.45
84 0.47
85 0.51
86 0.55
87 0.59
88 0.64
89 0.7
90 0.78
91 0.78
92 0.76
93 0.78
94 0.79
95 0.83
96 0.85
97 0.8
98 0.74
99 0.7
100 0.64
101 0.55
102 0.51
103 0.42
104 0.35
105 0.35
106 0.39
107 0.38
108 0.4
109 0.4
110 0.36
111 0.41
112 0.46
113 0.45
114 0.44
115 0.45
116 0.49
117 0.5
118 0.5
119 0.46
120 0.43
121 0.44
122 0.43
123 0.36
124 0.31
125 0.29
126 0.29
127 0.32
128 0.28
129 0.24
130 0.18
131 0.18
132 0.14
133 0.14
134 0.11
135 0.06
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.06
142 0.07
143 0.07
144 0.07
145 0.07
146 0.08
147 0.09
148 0.1
149 0.09
150 0.09
151 0.09
152 0.09
153 0.1
154 0.11
155 0.1
156 0.08
157 0.08
158 0.09
159 0.08
160 0.08
161 0.08
162 0.06
163 0.07
164 0.08
165 0.08
166 0.1
167 0.12
168 0.12
169 0.11
170 0.12
171 0.11
172 0.14
173 0.16
174 0.15
175 0.17
176 0.18
177 0.18
178 0.2
179 0.21
180 0.18
181 0.16
182 0.15
183 0.11
184 0.11
185 0.11
186 0.11
187 0.18
188 0.21
189 0.2
190 0.21
191 0.21
192 0.21
193 0.21
194 0.21
195 0.18
196 0.15
197 0.18
198 0.18
199 0.17
200 0.16
201 0.16
202 0.14
203 0.08
204 0.11
205 0.11
206 0.17
207 0.22
208 0.23
209 0.26
210 0.32
211 0.35
212 0.36
213 0.34
214 0.27
215 0.25
216 0.32
217 0.33
218 0.29
219 0.25
220 0.23
221 0.22
222 0.22
223 0.2
224 0.14
225 0.1
226 0.11
227 0.13
228 0.14
229 0.14
230 0.14
231 0.18
232 0.19
233 0.23
234 0.23
235 0.23
236 0.26
237 0.3
238 0.33
239 0.31
240 0.35
241 0.36
242 0.36
243 0.36
244 0.31
245 0.31
246 0.29
247 0.33
248 0.3
249 0.27
250 0.26
251 0.26
252 0.28
253 0.28
254 0.31
255 0.24
256 0.23
257 0.2
258 0.18
259 0.19
260 0.19
261 0.16
262 0.13
263 0.14
264 0.14
265 0.16
266 0.21
267 0.23
268 0.25
269 0.32
270 0.39
271 0.43
272 0.44
273 0.42
274 0.37
275 0.34
276 0.35
277 0.37
278 0.34
279 0.37
280 0.36
281 0.36
282 0.37
283 0.36
284 0.34
285 0.25
286 0.26
287 0.2
288 0.27
289 0.31
290 0.38
291 0.41
292 0.44
293 0.44
294 0.38
295 0.37
296 0.34
297 0.33
298 0.3
299 0.28
300 0.23
301 0.23
302 0.24
303 0.24
304 0.19
305 0.15
306 0.09
307 0.08
308 0.07
309 0.06
310 0.05
311 0.05
312 0.04
313 0.04
314 0.05
315 0.06
316 0.07
317 0.08
318 0.1
319 0.11
320 0.11
321 0.11
322 0.12
323 0.13
324 0.12
325 0.11
326 0.1
327 0.16
328 0.15
329 0.16
330 0.17
331 0.18
332 0.19
333 0.19
334 0.23
335 0.19
336 0.2
337 0.23
338 0.25
339 0.25
340 0.25
341 0.25
342 0.2
343 0.18
344 0.17
345 0.12
346 0.07
347 0.05
348 0.07
349 0.07
350 0.07
351 0.07
352 0.07
353 0.08
354 0.08
355 0.08
356 0.08
357 0.08
358 0.08
359 0.08
360 0.09
361 0.08
362 0.1
363 0.09
364 0.08
365 0.08
366 0.09
367 0.09
368 0.11
369 0.14
370 0.14
371 0.16
372 0.15
373 0.17
374 0.21
375 0.25
376 0.24
377 0.27
378 0.28
379 0.28
380 0.36
381 0.42
382 0.43
383 0.48
384 0.54
385 0.56
386 0.6
387 0.66
388 0.65
389 0.63
390 0.64
391 0.61
392 0.57
393 0.53
394 0.49
395 0.43
396 0.39
397 0.33
398 0.25
399 0.2
400 0.18
401 0.16
402 0.14
403 0.12
404 0.11
405 0.12
406 0.13
407 0.15
408 0.19
409 0.19
410 0.2
411 0.2
412 0.21
413 0.21
414 0.2
415 0.18
416 0.13
417 0.12
418 0.11
419 0.1
420 0.1
421 0.08
422 0.08
423 0.08
424 0.08
425 0.13
426 0.16
427 0.2
428 0.27
429 0.32
430 0.41