Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2K0WH23

Protein Details
Accession A0A2K0WH23    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-35DDITQAQRRSARRRPNQRRGAGRPAAHydrophilic
NLS Segment(s)
PositionSequence
17-59RRSARRRPNQRRGAGRPAAAAPVGGIQKSTKPARGAGAKPAPA
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MSGKLDQALDDITQAQRRSARRRPNQRRGAGRPAAAAPVGGIQKSTKPARGAGAKPAPAKATPTNSDSKIIVSNLPKDVSEQQIKVCFRCGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.25
4 0.32
5 0.4
6 0.47
7 0.55
8 0.61
9 0.72
10 0.8
11 0.85
12 0.88
13 0.88
14 0.89
15 0.85
16 0.84
17 0.76
18 0.66
19 0.57
20 0.47
21 0.4
22 0.3
23 0.22
24 0.13
25 0.11
26 0.11
27 0.08
28 0.08
29 0.07
30 0.09
31 0.14
32 0.15
33 0.15
34 0.16
35 0.18
36 0.21
37 0.27
38 0.27
39 0.3
40 0.33
41 0.34
42 0.34
43 0.34
44 0.32
45 0.26
46 0.3
47 0.26
48 0.27
49 0.25
50 0.28
51 0.32
52 0.32
53 0.34
54 0.29
55 0.27
56 0.24
57 0.22
58 0.23
59 0.22
60 0.25
61 0.26
62 0.26
63 0.25
64 0.26
65 0.29
66 0.31
67 0.34
68 0.31
69 0.33
70 0.4
71 0.43
72 0.4