Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0U3J3

Protein Details
Accession A0A2K0U3J3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
55-84RAKELKIEKEDRKRKRQAEKQESRKKNDTIBasic
NLS Segment(s)
PositionSequence
46-80RYPKPEEIWRAKELKIEKEDRKRKRQAEKQESRKK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MKTAEELDHLKAQNTIERQKSTYLQMEIDSQKPQPRRKVVWHPQARYPKPEEIWRAKELKIEKEDRKRKRQAEKQESRKKNDTIVVADESRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.34
4 0.36
5 0.37
6 0.39
7 0.4
8 0.39
9 0.39
10 0.34
11 0.28
12 0.27
13 0.3
14 0.29
15 0.29
16 0.26
17 0.22
18 0.26
19 0.33
20 0.38
21 0.41
22 0.45
23 0.48
24 0.55
25 0.64
26 0.68
27 0.72
28 0.74
29 0.68
30 0.69
31 0.75
32 0.68
33 0.61
34 0.55
35 0.49
36 0.42
37 0.45
38 0.44
39 0.41
40 0.44
41 0.44
42 0.42
43 0.39
44 0.41
45 0.39
46 0.39
47 0.38
48 0.41
49 0.45
50 0.54
51 0.63
52 0.68
53 0.75
54 0.78
55 0.8
56 0.84
57 0.85
58 0.85
59 0.87
60 0.88
61 0.89
62 0.91
63 0.9
64 0.88
65 0.86
66 0.77
67 0.71
68 0.66
69 0.6
70 0.53
71 0.49
72 0.46