A0A2K0WCH5
Protein Details
| Accession | A0A2K0WCH5  |
Localization Confidence | Medium | Confidence Score | 13.1 | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| NoLS Segment(s) |
|
||||||||||
| NLS Segment(s) |
|
||||||||||
| Subcellular Location(s) | nucl 22, mito 2, cyto 1.5, cyto_pero 1.5 | ||||||||||
| Family & Domain DBs |
|
||||||||||
| Amino Acid Sequences | MPPQMYPLEPKHPEYRKRKDRPDGILQGYD | ||||||||||
| FASTA Sequence with NoLS information |
|||||||||||
| AlphaFold Structure with highlighted NoLS |
|||||||||||
NoLS Predictions per Residue
| Residue Number | Score |
|---|---|
| 1 | 0.63 |
| 2 | 0.69 |
| 3 | 0.71 |
| 4 | 0.77 |
| 5 | 0.83 |
| 6 | 0.84 |
| 7 | 0.84 |
| 8 | 0.83 |
| 9 | 0.83 |
| 10 | 0.81 |