Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0WLC7

Protein Details
Accession A0A2K0WLC7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
40-88APPAIKSRRDLPQKVKKSYKKRANVTPVRKPQPGERKAFRKRIQLSNNSHydrophilic
NLS Segment(s)
PositionSequence
45-81KSRRDLPQKVKKSYKKRANVTPVRKPQPGERKAFRKR
Subcellular Location(s) mito 23, cyto_mito 12.833, mito_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR019368  Ribosomal_S23/S29_mit  
IPR017082  Ribosomal_S23_mit_fun  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF10236  DAP3  
Amino Acid Sequences MVSANSLRCLLRPTIPRAPRIQPVLLAPFSTSTAALAVSAPPAIKSRRDLPQKVKKSYKKRANVTPVRKPQPGERKAFRKRIQLSNNSALPVAGLENLDASNMTKAESAGKMFAIPDQVVDHLRALEAFKTTQTWNLFRKPHVLQRKETVELMKKLELSAKEKKALKCVLTGSKLSGKSMAMLQAMAYALLNNWVVFHVPEGQDLTNGNTEYSPIPETEPMQFSQPIYCLKMIQSLYRANRVVLEKLNIEKDWSKFTNLKEGATLADLALSAKEAEYAWPTLLALWTELTLPGRPPVLFALDGLAHINKISDYRDPSFNEVHAHELALVRLFIDALSGKTPLPNGGAVIAATSENNSHHHPSQELVLSQLEAGQAGREIPKPDPYERKYDERVYEALKNSWVLRLEGITKDEARSLMEYWGASGLFRHVLNSRTVSEKWTVGGHGNVGEMERAALMQMRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.58
4 0.6
5 0.63
6 0.63
7 0.61
8 0.55
9 0.47
10 0.48
11 0.49
12 0.43
13 0.37
14 0.3
15 0.26
16 0.25
17 0.23
18 0.18
19 0.11
20 0.11
21 0.1
22 0.1
23 0.09
24 0.08
25 0.08
26 0.09
27 0.09
28 0.09
29 0.14
30 0.17
31 0.2
32 0.25
33 0.31
34 0.39
35 0.49
36 0.57
37 0.63
38 0.71
39 0.77
40 0.82
41 0.86
42 0.86
43 0.87
44 0.9
45 0.89
46 0.88
47 0.87
48 0.88
49 0.88
50 0.89
51 0.88
52 0.88
53 0.88
54 0.85
55 0.8
56 0.72
57 0.71
58 0.71
59 0.7
60 0.68
61 0.67
62 0.71
63 0.76
64 0.84
65 0.81
66 0.8
67 0.79
68 0.8
69 0.8
70 0.79
71 0.77
72 0.75
73 0.7
74 0.61
75 0.53
76 0.43
77 0.33
78 0.24
79 0.16
80 0.09
81 0.07
82 0.06
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.08
89 0.08
90 0.08
91 0.08
92 0.09
93 0.12
94 0.14
95 0.14
96 0.13
97 0.13
98 0.13
99 0.13
100 0.14
101 0.13
102 0.11
103 0.11
104 0.11
105 0.12
106 0.12
107 0.13
108 0.13
109 0.1
110 0.1
111 0.1
112 0.1
113 0.1
114 0.11
115 0.1
116 0.1
117 0.13
118 0.13
119 0.18
120 0.21
121 0.25
122 0.29
123 0.36
124 0.39
125 0.37
126 0.44
127 0.42
128 0.48
129 0.53
130 0.52
131 0.49
132 0.53
133 0.57
134 0.52
135 0.5
136 0.47
137 0.43
138 0.42
139 0.41
140 0.35
141 0.3
142 0.29
143 0.31
144 0.28
145 0.27
146 0.33
147 0.33
148 0.38
149 0.44
150 0.45
151 0.48
152 0.49
153 0.44
154 0.39
155 0.4
156 0.39
157 0.36
158 0.35
159 0.31
160 0.33
161 0.32
162 0.28
163 0.25
164 0.19
165 0.17
166 0.18
167 0.17
168 0.11
169 0.11
170 0.1
171 0.09
172 0.09
173 0.08
174 0.07
175 0.04
176 0.04
177 0.06
178 0.06
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.06
185 0.09
186 0.09
187 0.1
188 0.11
189 0.11
190 0.12
191 0.12
192 0.13
193 0.11
194 0.11
195 0.11
196 0.09
197 0.1
198 0.1
199 0.11
200 0.1
201 0.08
202 0.09
203 0.09
204 0.11
205 0.12
206 0.13
207 0.12
208 0.14
209 0.14
210 0.13
211 0.13
212 0.14
213 0.13
214 0.13
215 0.13
216 0.11
217 0.11
218 0.16
219 0.16
220 0.16
221 0.17
222 0.21
223 0.23
224 0.27
225 0.27
226 0.22
227 0.25
228 0.25
229 0.24
230 0.2
231 0.2
232 0.16
233 0.18
234 0.2
235 0.16
236 0.17
237 0.18
238 0.17
239 0.21
240 0.21
241 0.23
242 0.25
243 0.26
244 0.33
245 0.31
246 0.3
247 0.25
248 0.24
249 0.21
250 0.18
251 0.17
252 0.07
253 0.06
254 0.06
255 0.05
256 0.05
257 0.04
258 0.04
259 0.03
260 0.04
261 0.04
262 0.05
263 0.07
264 0.07
265 0.07
266 0.07
267 0.07
268 0.07
269 0.08
270 0.07
271 0.06
272 0.05
273 0.05
274 0.06
275 0.06
276 0.07
277 0.07
278 0.08
279 0.09
280 0.1
281 0.1
282 0.1
283 0.11
284 0.12
285 0.11
286 0.11
287 0.11
288 0.1
289 0.1
290 0.1
291 0.09
292 0.07
293 0.07
294 0.07
295 0.05
296 0.07
297 0.08
298 0.11
299 0.16
300 0.19
301 0.25
302 0.26
303 0.3
304 0.3
305 0.3
306 0.29
307 0.25
308 0.25
309 0.2
310 0.18
311 0.16
312 0.15
313 0.14
314 0.11
315 0.1
316 0.07
317 0.07
318 0.06
319 0.05
320 0.06
321 0.06
322 0.06
323 0.08
324 0.08
325 0.09
326 0.1
327 0.1
328 0.1
329 0.11
330 0.11
331 0.1
332 0.09
333 0.1
334 0.08
335 0.08
336 0.07
337 0.06
338 0.06
339 0.06
340 0.07
341 0.08
342 0.1
343 0.14
344 0.18
345 0.2
346 0.22
347 0.22
348 0.22
349 0.25
350 0.26
351 0.22
352 0.2
353 0.18
354 0.16
355 0.15
356 0.15
357 0.11
358 0.08
359 0.08
360 0.06
361 0.06
362 0.07
363 0.1
364 0.12
365 0.15
366 0.17
367 0.24
368 0.28
369 0.35
370 0.44
371 0.45
372 0.52
373 0.54
374 0.6
375 0.59
376 0.62
377 0.58
378 0.52
379 0.52
380 0.47
381 0.48
382 0.44
383 0.4
384 0.34
385 0.33
386 0.29
387 0.31
388 0.28
389 0.22
390 0.2
391 0.21
392 0.22
393 0.23
394 0.24
395 0.23
396 0.23
397 0.23
398 0.24
399 0.22
400 0.2
401 0.2
402 0.19
403 0.17
404 0.18
405 0.17
406 0.15
407 0.17
408 0.15
409 0.12
410 0.12
411 0.12
412 0.13
413 0.13
414 0.15
415 0.17
416 0.19
417 0.24
418 0.27
419 0.26
420 0.29
421 0.29
422 0.31
423 0.31
424 0.3
425 0.27
426 0.26
427 0.25
428 0.23
429 0.24
430 0.22
431 0.2
432 0.19
433 0.18
434 0.17
435 0.15
436 0.12
437 0.1
438 0.09
439 0.08
440 0.07