Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7S2F9

Protein Details
Accession J7S2F9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
224-253EDDGSVSGEKKKKKKKNKKNKDKSNTSVSMHydrophilic
NLS Segment(s)
PositionSequence
92-97PMKRKV
232-246EKKKKKKKNKKNKDK
Subcellular Location(s) nucl 17, cyto_nucl 11.333, mito_nucl 10.333, cyto 4.5, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd22015  HMG-box_HMO1-like  
Amino Acid Sequences MTTDASAKLKVAKDSLVSSLFELSKAANQTASSIVDFYNNIGEDEEEKIEAFTTLTESLQMLTAATDQFGGITSDLLNPLDDEKDAGRAKTPMKRKVERDPNAPKKPLTVFFAYSAYVRQELRDARQKAGLAPLSSTEITQEISKKWKELSDAEKEKWKQAYHVELEHYQKAKQEYLENKKNGTLPVLDGPSHAPVPIPFGLLHHDEEPEPVVPAHFEEKRHREDDGSVSGEKKKKKKKNKKNKDKSNTSVSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.27
4 0.24
5 0.22
6 0.25
7 0.22
8 0.2
9 0.18
10 0.15
11 0.17
12 0.19
13 0.18
14 0.15
15 0.15
16 0.17
17 0.19
18 0.19
19 0.15
20 0.14
21 0.13
22 0.13
23 0.14
24 0.13
25 0.14
26 0.13
27 0.13
28 0.13
29 0.13
30 0.13
31 0.15
32 0.15
33 0.11
34 0.11
35 0.11
36 0.1
37 0.1
38 0.08
39 0.06
40 0.08
41 0.08
42 0.08
43 0.09
44 0.09
45 0.09
46 0.09
47 0.09
48 0.06
49 0.06
50 0.07
51 0.07
52 0.06
53 0.06
54 0.05
55 0.05
56 0.06
57 0.06
58 0.05
59 0.06
60 0.06
61 0.07
62 0.08
63 0.08
64 0.07
65 0.07
66 0.08
67 0.08
68 0.07
69 0.08
70 0.07
71 0.14
72 0.14
73 0.14
74 0.15
75 0.18
76 0.22
77 0.28
78 0.36
79 0.38
80 0.46
81 0.53
82 0.56
83 0.64
84 0.7
85 0.69
86 0.7
87 0.73
88 0.75
89 0.75
90 0.72
91 0.61
92 0.54
93 0.52
94 0.46
95 0.38
96 0.31
97 0.25
98 0.24
99 0.25
100 0.22
101 0.18
102 0.16
103 0.13
104 0.12
105 0.11
106 0.09
107 0.12
108 0.13
109 0.17
110 0.26
111 0.27
112 0.26
113 0.29
114 0.29
115 0.25
116 0.29
117 0.26
118 0.17
119 0.15
120 0.15
121 0.15
122 0.14
123 0.14
124 0.09
125 0.08
126 0.08
127 0.09
128 0.1
129 0.1
130 0.15
131 0.16
132 0.17
133 0.18
134 0.19
135 0.21
136 0.24
137 0.29
138 0.33
139 0.38
140 0.38
141 0.45
142 0.44
143 0.46
144 0.45
145 0.39
146 0.32
147 0.32
148 0.37
149 0.32
150 0.34
151 0.33
152 0.32
153 0.36
154 0.37
155 0.34
156 0.28
157 0.28
158 0.28
159 0.27
160 0.25
161 0.29
162 0.33
163 0.42
164 0.51
165 0.49
166 0.48
167 0.48
168 0.49
169 0.42
170 0.35
171 0.26
172 0.19
173 0.22
174 0.23
175 0.2
176 0.18
177 0.19
178 0.19
179 0.19
180 0.16
181 0.12
182 0.1
183 0.15
184 0.15
185 0.14
186 0.12
187 0.13
188 0.16
189 0.18
190 0.2
191 0.16
192 0.17
193 0.16
194 0.17
195 0.18
196 0.15
197 0.14
198 0.12
199 0.11
200 0.1
201 0.12
202 0.18
203 0.18
204 0.22
205 0.31
206 0.38
207 0.44
208 0.46
209 0.45
210 0.41
211 0.42
212 0.43
213 0.39
214 0.36
215 0.31
216 0.32
217 0.38
218 0.42
219 0.47
220 0.51
221 0.56
222 0.63
223 0.73
224 0.82
225 0.86
226 0.92
227 0.95
228 0.96
229 0.97
230 0.98
231 0.97
232 0.96
233 0.92