Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7REQ8

Protein Details
Accession J7REQ8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
37-59AVYQAEKTKKTKKQQDFNPKYMGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR024621  Mba1  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0032979  P:protein insertion into mitochondrial inner membrane from matrix  
Pfam View protein in Pfam  
PF07961  MBA1  
Amino Acid Sequences MRSVMLKSRALPRILNVQSTLLLREFNKARLFSTGRAVYQAEKTKKTKKQQDFNPKYMGVGNKIFIPTSYNNLPNLFFHPLIVLKALIRRIYTFGLNTFKIGIFRFQTGVKPNFLLWKNKAIESYIQVNKAFVNRDVDSVRRQVSLWVEDSLTTRVKMLPKNLVLEWQILKFNGPPRLVALEPIMAPGQPLEYLQLVYKFDTEQELIKLNTVTKETEKQLKNVIDYMVFLCDTTTNDLYLSGSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.35
4 0.31
5 0.31
6 0.3
7 0.29
8 0.2
9 0.2
10 0.18
11 0.24
12 0.25
13 0.28
14 0.33
15 0.31
16 0.32
17 0.36
18 0.39
19 0.34
20 0.4
21 0.38
22 0.33
23 0.34
24 0.34
25 0.3
26 0.34
27 0.41
28 0.38
29 0.42
30 0.48
31 0.55
32 0.63
33 0.71
34 0.74
35 0.75
36 0.79
37 0.83
38 0.88
39 0.87
40 0.83
41 0.79
42 0.68
43 0.59
44 0.53
45 0.45
46 0.38
47 0.31
48 0.26
49 0.22
50 0.23
51 0.21
52 0.17
53 0.19
54 0.16
55 0.19
56 0.23
57 0.23
58 0.24
59 0.25
60 0.26
61 0.22
62 0.25
63 0.23
64 0.19
65 0.17
66 0.17
67 0.16
68 0.16
69 0.15
70 0.11
71 0.08
72 0.11
73 0.13
74 0.13
75 0.13
76 0.14
77 0.15
78 0.17
79 0.17
80 0.15
81 0.16
82 0.19
83 0.18
84 0.18
85 0.16
86 0.15
87 0.15
88 0.15
89 0.15
90 0.12
91 0.13
92 0.14
93 0.13
94 0.16
95 0.21
96 0.23
97 0.21
98 0.2
99 0.2
100 0.25
101 0.27
102 0.29
103 0.24
104 0.3
105 0.31
106 0.31
107 0.31
108 0.25
109 0.24
110 0.22
111 0.27
112 0.21
113 0.22
114 0.21
115 0.21
116 0.21
117 0.21
118 0.2
119 0.14
120 0.17
121 0.15
122 0.18
123 0.18
124 0.2
125 0.2
126 0.22
127 0.21
128 0.17
129 0.17
130 0.17
131 0.18
132 0.19
133 0.18
134 0.16
135 0.15
136 0.15
137 0.16
138 0.16
139 0.15
140 0.12
141 0.11
142 0.13
143 0.18
144 0.2
145 0.23
146 0.27
147 0.28
148 0.31
149 0.31
150 0.31
151 0.28
152 0.28
153 0.26
154 0.21
155 0.2
156 0.16
157 0.17
158 0.17
159 0.21
160 0.25
161 0.24
162 0.22
163 0.24
164 0.27
165 0.27
166 0.25
167 0.21
168 0.16
169 0.15
170 0.16
171 0.14
172 0.1
173 0.1
174 0.09
175 0.08
176 0.06
177 0.06
178 0.07
179 0.07
180 0.08
181 0.1
182 0.13
183 0.13
184 0.14
185 0.14
186 0.13
187 0.13
188 0.15
189 0.15
190 0.14
191 0.15
192 0.18
193 0.17
194 0.19
195 0.19
196 0.18
197 0.2
198 0.19
199 0.21
200 0.21
201 0.27
202 0.3
203 0.39
204 0.4
205 0.4
206 0.47
207 0.47
208 0.45
209 0.43
210 0.39
211 0.3
212 0.29
213 0.27
214 0.21
215 0.17
216 0.15
217 0.12
218 0.12
219 0.13
220 0.18
221 0.18
222 0.16
223 0.16
224 0.17