Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0VUD3

Protein Details
Accession A0A2K0VUD3    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
92-119DNGADGQRTPKRRKKPASKGAQSKPIQEHydrophilic
NLS Segment(s)
PositionSequence
100-111TPKRRKKPASKG
Subcellular Location(s) cyto 14, nucl 7, cyto_pero 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029526  PGBD  
Pfam View protein in Pfam  
PF13843  DDE_Tnp_1_7  
Amino Acid Sequences MLPKQTYHFFMDNRFASPDLFRVLQEAGHGATGTARPNCGITKELKLVKGKDKAGASGFKYNKVKSIPTIDGLVAQIAWKDNSLVLFLSTVDNGADGQRTPKRRKKPASKGAQSKPIQETLVML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.32
3 0.28
4 0.27
5 0.25
6 0.2
7 0.19
8 0.17
9 0.17
10 0.17
11 0.15
12 0.14
13 0.13
14 0.1
15 0.09
16 0.09
17 0.07
18 0.08
19 0.09
20 0.13
21 0.12
22 0.12
23 0.12
24 0.14
25 0.14
26 0.15
27 0.15
28 0.14
29 0.18
30 0.24
31 0.26
32 0.29
33 0.32
34 0.34
35 0.39
36 0.43
37 0.39
38 0.38
39 0.36
40 0.34
41 0.32
42 0.32
43 0.28
44 0.3
45 0.3
46 0.31
47 0.34
48 0.32
49 0.33
50 0.31
51 0.29
52 0.24
53 0.29
54 0.24
55 0.22
56 0.23
57 0.19
58 0.18
59 0.17
60 0.14
61 0.08
62 0.07
63 0.06
64 0.06
65 0.06
66 0.05
67 0.06
68 0.06
69 0.07
70 0.07
71 0.07
72 0.06
73 0.07
74 0.07
75 0.08
76 0.07
77 0.07
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.06
84 0.13
85 0.19
86 0.27
87 0.37
88 0.46
89 0.56
90 0.65
91 0.76
92 0.81
93 0.86
94 0.89
95 0.91
96 0.92
97 0.92
98 0.9
99 0.89
100 0.8
101 0.76
102 0.7
103 0.63
104 0.53