Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2K0VXK0

Protein Details
Accession A0A2K0VXK0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
51-75NADSKESRARNKKQKKSFLFRNHGGHydrophilic
NLS Segment(s)
PositionSequence
60-65RNKKQK
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences MCLPFSTRLQDPVDPPPRYYKNYDSKYPVSGSSAYSRQRDQARTNKINEMNADSKESRARNKKQKKSFLFRNHGGGASTLHHGSIAGAIAGGAMGGGGGAGGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.49
4 0.5
5 0.51
6 0.53
7 0.52
8 0.53
9 0.57
10 0.62
11 0.59
12 0.56
13 0.55
14 0.51
15 0.43
16 0.35
17 0.3
18 0.26
19 0.24
20 0.27
21 0.27
22 0.28
23 0.28
24 0.31
25 0.35
26 0.38
27 0.41
28 0.44
29 0.5
30 0.53
31 0.55
32 0.56
33 0.52
34 0.49
35 0.43
36 0.39
37 0.31
38 0.27
39 0.27
40 0.21
41 0.2
42 0.23
43 0.24
44 0.27
45 0.34
46 0.43
47 0.5
48 0.61
49 0.69
50 0.74
51 0.83
52 0.84
53 0.85
54 0.86
55 0.86
56 0.83
57 0.77
58 0.73
59 0.64
60 0.55
61 0.46
62 0.36
63 0.27
64 0.21
65 0.2
66 0.14
67 0.12
68 0.11
69 0.1
70 0.1
71 0.09
72 0.07
73 0.05
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.02
80 0.02
81 0.02
82 0.01
83 0.01