Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0WQW5

Protein Details
Accession A0A2K0WQW5    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-40GGALKLKGAKIHKKKKKRDKTDLEKNLDTBasic
NLS Segment(s)
PositionSequence
15-32LKLKGAKIHKKKKKRDKT
46-51EKRKKK
85-86KK
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MGSDDYAAVGGGGALKLKGAKIHKKKKKRDKTDLEKNLDTGNKDEEKRKKKSEDGEEQEPHDEDDEDKPEVQKTEAQKRHEEIKKKRATAQTRRVFKLATGTSQNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.07
5 0.13
6 0.2
7 0.3
8 0.41
9 0.52
10 0.62
11 0.72
12 0.83
13 0.88
14 0.92
15 0.92
16 0.93
17 0.93
18 0.93
19 0.94
20 0.93
21 0.89
22 0.78
23 0.68
24 0.61
25 0.52
26 0.42
27 0.32
28 0.27
29 0.24
30 0.25
31 0.31
32 0.37
33 0.43
34 0.48
35 0.53
36 0.53
37 0.54
38 0.61
39 0.62
40 0.63
41 0.61
42 0.62
43 0.58
44 0.54
45 0.5
46 0.41
47 0.32
48 0.23
49 0.17
50 0.1
51 0.12
52 0.13
53 0.13
54 0.13
55 0.14
56 0.14
57 0.15
58 0.15
59 0.17
60 0.21
61 0.31
62 0.37
63 0.4
64 0.44
65 0.46
66 0.55
67 0.58
68 0.62
69 0.6
70 0.65
71 0.7
72 0.68
73 0.73
74 0.73
75 0.76
76 0.76
77 0.78
78 0.77
79 0.76
80 0.77
81 0.71
82 0.62
83 0.53
84 0.52
85 0.45
86 0.41