Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0WP27

Protein Details
Accession A0A2K0WP27    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
82-104QMCDEFKKKTKPPKGAVMPKAQNHydrophilic
NLS Segment(s)
PositionSequence
92-92K
Subcellular Location(s) cyto_nucl 12.333, cyto 11.5, nucl 11, cyto_pero 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR011330  Glyco_hydro/deAcase_b/a-brl  
Gene Ontology GO:0005975  P:carbohydrate metabolic process  
Amino Acid Sequences MMFIKDAPNSHGWVNSRDVEDLWRDHFDYFYREYADDPDEICVFPLTVHPDVSGRPHALLMHERLIEYINKHEGVEWVTMEQMCDEFKKKTKPPKGAVMPKAQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.28
4 0.26
5 0.26
6 0.24
7 0.24
8 0.23
9 0.22
10 0.21
11 0.2
12 0.2
13 0.2
14 0.19
15 0.19
16 0.2
17 0.19
18 0.19
19 0.18
20 0.18
21 0.2
22 0.2
23 0.17
24 0.14
25 0.14
26 0.12
27 0.12
28 0.12
29 0.09
30 0.07
31 0.07
32 0.08
33 0.11
34 0.11
35 0.11
36 0.11
37 0.11
38 0.12
39 0.14
40 0.14
41 0.11
42 0.1
43 0.1
44 0.1
45 0.12
46 0.14
47 0.14
48 0.15
49 0.15
50 0.15
51 0.15
52 0.16
53 0.15
54 0.14
55 0.15
56 0.15
57 0.15
58 0.15
59 0.15
60 0.15
61 0.16
62 0.16
63 0.13
64 0.11
65 0.12
66 0.12
67 0.11
68 0.1
69 0.09
70 0.09
71 0.11
72 0.14
73 0.17
74 0.23
75 0.33
76 0.4
77 0.51
78 0.6
79 0.67
80 0.71
81 0.77
82 0.82
83 0.83
84 0.82