Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0WP54

Protein Details
Accession A0A2K0WP54    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
57-86TPVTTYNPAKSRRKSRKKSRRTGSIPSLPNHydrophilic
NLS Segment(s)
PositionSequence
66-77KSRRKSRKKSRR
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR032675  LRR_dom_sf  
Amino Acid Sequences MEIARPPKSLRADRFERNIQALRIIAQQRPDDPEAQRRAQVATDLYLQTWPHHTLPTPVTTYNPAKSRRKSRKKSRRTGSIPSLPNEIYEMIFGYILAEYPTNNRERLFDACPNVTRFSLNASASDSNDSVAFQTNKQFFKFWNQLTHVEGLRCSESEDIISISKRCPSLQRLKIDCFGRLDPGTLLDASQIWGKTLRTLNLDWLEMPSETTIAQLLEHLPKIEEVFLGHLHDILPSIHALAHLSLPQLKRLRVASYRKWNTDHSQEEDAAICGMITAHADTLESLSLTCLYVLSRSVLEAIKKAKKLEFLNLEVLRVLTDEEREELQAACPKLRIFVNFLADTPRKVCTENSTGPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.68
4 0.65
5 0.62
6 0.54
7 0.5
8 0.42
9 0.37
10 0.37
11 0.36
12 0.32
13 0.33
14 0.34
15 0.34
16 0.4
17 0.41
18 0.38
19 0.39
20 0.46
21 0.48
22 0.48
23 0.48
24 0.43
25 0.42
26 0.37
27 0.36
28 0.28
29 0.24
30 0.25
31 0.22
32 0.21
33 0.22
34 0.22
35 0.2
36 0.22
37 0.24
38 0.21
39 0.22
40 0.22
41 0.25
42 0.28
43 0.31
44 0.3
45 0.27
46 0.28
47 0.33
48 0.36
49 0.37
50 0.4
51 0.44
52 0.5
53 0.58
54 0.67
55 0.72
56 0.79
57 0.84
58 0.88
59 0.91
60 0.93
61 0.95
62 0.94
63 0.94
64 0.9
65 0.88
66 0.87
67 0.84
68 0.78
69 0.69
70 0.63
71 0.52
72 0.45
73 0.37
74 0.28
75 0.19
76 0.14
77 0.13
78 0.08
79 0.08
80 0.08
81 0.07
82 0.06
83 0.06
84 0.06
85 0.05
86 0.05
87 0.08
88 0.12
89 0.14
90 0.15
91 0.16
92 0.17
93 0.2
94 0.24
95 0.26
96 0.27
97 0.29
98 0.31
99 0.33
100 0.34
101 0.33
102 0.29
103 0.25
104 0.2
105 0.2
106 0.22
107 0.19
108 0.18
109 0.19
110 0.2
111 0.2
112 0.22
113 0.18
114 0.13
115 0.13
116 0.12
117 0.09
118 0.13
119 0.13
120 0.12
121 0.18
122 0.23
123 0.25
124 0.26
125 0.26
126 0.23
127 0.3
128 0.37
129 0.33
130 0.35
131 0.36
132 0.37
133 0.38
134 0.4
135 0.33
136 0.26
137 0.24
138 0.18
139 0.15
140 0.14
141 0.12
142 0.1
143 0.08
144 0.08
145 0.08
146 0.08
147 0.08
148 0.09
149 0.09
150 0.09
151 0.12
152 0.12
153 0.12
154 0.16
155 0.22
156 0.31
157 0.37
158 0.45
159 0.46
160 0.49
161 0.53
162 0.5
163 0.45
164 0.38
165 0.31
166 0.26
167 0.22
168 0.2
169 0.14
170 0.14
171 0.13
172 0.1
173 0.09
174 0.06
175 0.06
176 0.06
177 0.08
178 0.07
179 0.07
180 0.08
181 0.08
182 0.13
183 0.14
184 0.16
185 0.17
186 0.17
187 0.22
188 0.22
189 0.22
190 0.17
191 0.16
192 0.15
193 0.12
194 0.12
195 0.08
196 0.07
197 0.06
198 0.06
199 0.06
200 0.05
201 0.05
202 0.05
203 0.07
204 0.09
205 0.09
206 0.09
207 0.09
208 0.09
209 0.1
210 0.1
211 0.08
212 0.06
213 0.08
214 0.08
215 0.09
216 0.09
217 0.08
218 0.08
219 0.08
220 0.08
221 0.07
222 0.07
223 0.06
224 0.06
225 0.06
226 0.06
227 0.07
228 0.06
229 0.07
230 0.07
231 0.08
232 0.12
233 0.12
234 0.19
235 0.22
236 0.22
237 0.25
238 0.26
239 0.31
240 0.35
241 0.43
242 0.46
243 0.53
244 0.6
245 0.6
246 0.62
247 0.61
248 0.58
249 0.59
250 0.55
251 0.49
252 0.46
253 0.42
254 0.39
255 0.35
256 0.3
257 0.21
258 0.15
259 0.1
260 0.06
261 0.06
262 0.05
263 0.05
264 0.05
265 0.05
266 0.05
267 0.05
268 0.05
269 0.06
270 0.06
271 0.06
272 0.06
273 0.06
274 0.07
275 0.07
276 0.07
277 0.06
278 0.06
279 0.07
280 0.08
281 0.09
282 0.09
283 0.09
284 0.11
285 0.14
286 0.15
287 0.18
288 0.26
289 0.31
290 0.34
291 0.37
292 0.38
293 0.43
294 0.44
295 0.49
296 0.48
297 0.45
298 0.51
299 0.49
300 0.46
301 0.39
302 0.36
303 0.26
304 0.2
305 0.17
306 0.09
307 0.11
308 0.11
309 0.13
310 0.14
311 0.15
312 0.16
313 0.15
314 0.17
315 0.22
316 0.22
317 0.22
318 0.23
319 0.23
320 0.26
321 0.29
322 0.27
323 0.27
324 0.32
325 0.37
326 0.35
327 0.36
328 0.4
329 0.38
330 0.38
331 0.34
332 0.32
333 0.26
334 0.27
335 0.3
336 0.29
337 0.37