Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2K0WH35

Protein Details
Accession A0A2K0WH35    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-40VSEQRERYKNAKRRGPPNLETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 11.5, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010997  HRDC-like_sf  
IPR006590  RNA_pol_Rpb4/RPC9_core  
IPR005574  Rpb4/RPC9  
IPR038324  Rpb4/RPC9_sf  
IPR038846  RPC9  
Gene Ontology GO:0005666  C:RNA polymerase III complex  
GO:0000166  F:nucleotide binding  
GO:0006384  P:transcription initiation at RNA polymerase III promoter  
Pfam View protein in Pfam  
PF03874  RNA_pol_Rpb4  
Amino Acid Sequences MKILEAQSAVLTNYEVYQHVSEQRERYKNAKRRGPPNLETVVRELLQYLRTNPGPLSQEPLPYTEGCISRLLERLRPYNLAKGEVVMIINLRPASVAALNTVVEEMSERFSEEQQEAMVNIIAEVLGQFPAAEEGAEEEGADVSMNDPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.13
5 0.14
6 0.2
7 0.24
8 0.28
9 0.33
10 0.42
11 0.45
12 0.47
13 0.54
14 0.59
15 0.63
16 0.69
17 0.72
18 0.71
19 0.74
20 0.81
21 0.81
22 0.74
23 0.71
24 0.68
25 0.6
26 0.53
27 0.47
28 0.39
29 0.3
30 0.27
31 0.21
32 0.16
33 0.17
34 0.17
35 0.15
36 0.17
37 0.17
38 0.19
39 0.18
40 0.21
41 0.21
42 0.2
43 0.24
44 0.2
45 0.23
46 0.22
47 0.24
48 0.21
49 0.18
50 0.19
51 0.17
52 0.17
53 0.15
54 0.16
55 0.15
56 0.15
57 0.2
58 0.19
59 0.19
60 0.21
61 0.22
62 0.22
63 0.25
64 0.25
65 0.26
66 0.26
67 0.24
68 0.21
69 0.19
70 0.18
71 0.15
72 0.13
73 0.08
74 0.07
75 0.05
76 0.07
77 0.06
78 0.05
79 0.05
80 0.05
81 0.06
82 0.07
83 0.07
84 0.06
85 0.07
86 0.07
87 0.07
88 0.07
89 0.06
90 0.05
91 0.06
92 0.06
93 0.07
94 0.07
95 0.08
96 0.09
97 0.1
98 0.13
99 0.12
100 0.12
101 0.11
102 0.11
103 0.11
104 0.11
105 0.11
106 0.07
107 0.07
108 0.06
109 0.05
110 0.05
111 0.05
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.05
118 0.06
119 0.05
120 0.05
121 0.07
122 0.08
123 0.09
124 0.08
125 0.07
126 0.08
127 0.08
128 0.08
129 0.06
130 0.05