Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2K0UNF1

Protein Details
Accession A0A2K0UNF1    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
51-85IPYRSSPEERRKRTNENKKKLYHKKKEDEKNNSEWBasic
NLS Segment(s)
PositionSequence
60-77RRKRTNENKKKLYHKKKE
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MARSGYDRSGPGYFDVTDPFLSKEQTLDKYYPDIPKEQRPVLGHTALTTEIPYRSSPEERRKRTNENKKKLYHKKKEDEKNNSEWKPVPEAETPSVNKGHTIRMVKKGKKVDPDTDNEPSTKTYDQKQALEQSLDKIRNETSPYTSVDDIPTRVTSKRPNRHYSDPDYASALRTVQDLKAKKIKRRVNQTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.18
4 0.18
5 0.18
6 0.19
7 0.18
8 0.18
9 0.17
10 0.18
11 0.22
12 0.26
13 0.29
14 0.27
15 0.27
16 0.3
17 0.35
18 0.37
19 0.34
20 0.37
21 0.37
22 0.45
23 0.5
24 0.48
25 0.49
26 0.45
27 0.48
28 0.46
29 0.43
30 0.34
31 0.28
32 0.28
33 0.22
34 0.2
35 0.15
36 0.12
37 0.1
38 0.11
39 0.11
40 0.13
41 0.16
42 0.22
43 0.3
44 0.4
45 0.49
46 0.55
47 0.64
48 0.67
49 0.74
50 0.78
51 0.82
52 0.82
53 0.82
54 0.84
55 0.82
56 0.87
57 0.88
58 0.88
59 0.87
60 0.86
61 0.86
62 0.87
63 0.9
64 0.89
65 0.88
66 0.82
67 0.8
68 0.79
69 0.69
70 0.62
71 0.54
72 0.46
73 0.4
74 0.35
75 0.3
76 0.23
77 0.25
78 0.24
79 0.26
80 0.25
81 0.22
82 0.23
83 0.19
84 0.19
85 0.16
86 0.17
87 0.18
88 0.22
89 0.24
90 0.33
91 0.42
92 0.43
93 0.49
94 0.54
95 0.53
96 0.57
97 0.58
98 0.56
99 0.52
100 0.53
101 0.52
102 0.49
103 0.46
104 0.37
105 0.33
106 0.27
107 0.25
108 0.23
109 0.19
110 0.2
111 0.27
112 0.31
113 0.32
114 0.35
115 0.37
116 0.37
117 0.37
118 0.33
119 0.29
120 0.32
121 0.33
122 0.29
123 0.25
124 0.24
125 0.25
126 0.28
127 0.26
128 0.23
129 0.23
130 0.26
131 0.27
132 0.27
133 0.25
134 0.25
135 0.24
136 0.21
137 0.21
138 0.2
139 0.19
140 0.2
141 0.23
142 0.3
143 0.39
144 0.48
145 0.55
146 0.62
147 0.67
148 0.76
149 0.79
150 0.77
151 0.76
152 0.69
153 0.61
154 0.57
155 0.5
156 0.42
157 0.35
158 0.27
159 0.18
160 0.16
161 0.17
162 0.17
163 0.24
164 0.26
165 0.33
166 0.42
167 0.49
168 0.55
169 0.64
170 0.7
171 0.72