Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0WBB2

Protein Details
Accession A0A2K0WBB2    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
38-64ASVKSQGAYKKKPKRGIPKKLGAKRTGHydrophilic
197-232AKTTGLKTKRFRTRKQWFRHRRWRRERELEGQRKAABasic
243-263KAVKVLSQKQAKKAKKASKKKHydrophilic
NLS Segment(s)
PositionSequence
46-62YKKKPKRGIPKKLGAKR
201-263GLKTKRFRTRKQWFRHRRWRRERELEGQRKAAQKRAESGGEIKAVKVLSQKQAKKAKKASKKK
Subcellular Location(s) mito 21.5, cyto_mito 11.5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences MQRPILAAVATLARPAFTPVAPLGVQLANSLVQGHRFASVKSQGAYKKKPKRGIPKKLGAKRTGDQFVIPGNILYKQRGTHWWPGENCIMGRDHTIHAMATGYVKYYRDPSLHPDRKYIGVVFDKNDTLPYPVHAQRKRKLNMTAFPIKEVAAQPEISPSGIPFQVNRVEAGEPDRLLKLRKDYSYREDNWAIGKLAKTTGLKTKRFRTRKQWFRHRRWRRERELEGQRKAAQKRAESGGEIKAVKVLSQKQAKKAKKASKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.15
4 0.12
5 0.15
6 0.14
7 0.18
8 0.18
9 0.17
10 0.17
11 0.16
12 0.16
13 0.13
14 0.14
15 0.1
16 0.1
17 0.12
18 0.09
19 0.1
20 0.11
21 0.12
22 0.14
23 0.14
24 0.15
25 0.2
26 0.25
27 0.26
28 0.26
29 0.32
30 0.36
31 0.43
32 0.53
33 0.57
34 0.61
35 0.68
36 0.75
37 0.79
38 0.83
39 0.86
40 0.88
41 0.87
42 0.87
43 0.89
44 0.88
45 0.87
46 0.8
47 0.75
48 0.68
49 0.65
50 0.59
51 0.49
52 0.4
53 0.34
54 0.31
55 0.26
56 0.22
57 0.14
58 0.11
59 0.14
60 0.15
61 0.16
62 0.15
63 0.15
64 0.17
65 0.23
66 0.28
67 0.33
68 0.37
69 0.42
70 0.41
71 0.44
72 0.43
73 0.39
74 0.33
75 0.26
76 0.22
77 0.16
78 0.16
79 0.15
80 0.13
81 0.12
82 0.13
83 0.11
84 0.1
85 0.1
86 0.08
87 0.07
88 0.07
89 0.07
90 0.08
91 0.08
92 0.09
93 0.11
94 0.14
95 0.14
96 0.15
97 0.22
98 0.32
99 0.38
100 0.39
101 0.39
102 0.38
103 0.39
104 0.39
105 0.32
106 0.25
107 0.22
108 0.22
109 0.2
110 0.2
111 0.18
112 0.17
113 0.17
114 0.13
115 0.11
116 0.09
117 0.1
118 0.13
119 0.18
120 0.27
121 0.32
122 0.38
123 0.42
124 0.52
125 0.53
126 0.54
127 0.56
128 0.53
129 0.52
130 0.53
131 0.55
132 0.46
133 0.44
134 0.39
135 0.32
136 0.29
137 0.24
138 0.19
139 0.13
140 0.13
141 0.12
142 0.13
143 0.13
144 0.11
145 0.1
146 0.08
147 0.08
148 0.09
149 0.09
150 0.08
151 0.11
152 0.15
153 0.15
154 0.15
155 0.15
156 0.14
157 0.15
158 0.18
159 0.17
160 0.13
161 0.14
162 0.15
163 0.14
164 0.16
165 0.18
166 0.22
167 0.26
168 0.3
169 0.34
170 0.38
171 0.44
172 0.51
173 0.51
174 0.5
175 0.46
176 0.42
177 0.39
178 0.36
179 0.3
180 0.24
181 0.22
182 0.16
183 0.16
184 0.19
185 0.18
186 0.18
187 0.27
188 0.33
189 0.4
190 0.46
191 0.55
192 0.61
193 0.69
194 0.75
195 0.76
196 0.79
197 0.82
198 0.86
199 0.88
200 0.88
201 0.91
202 0.94
203 0.94
204 0.94
205 0.95
206 0.95
207 0.94
208 0.94
209 0.9
210 0.89
211 0.89
212 0.87
213 0.82
214 0.77
215 0.71
216 0.69
217 0.64
218 0.61
219 0.56
220 0.5
221 0.5
222 0.51
223 0.48
224 0.43
225 0.43
226 0.4
227 0.39
228 0.35
229 0.29
230 0.26
231 0.24
232 0.23
233 0.26
234 0.28
235 0.32
236 0.41
237 0.47
238 0.54
239 0.64
240 0.7
241 0.74
242 0.78
243 0.8