Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3ASY4

Protein Details
Accession G3ASY4    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSTQQRKIYKNQSKRFNTPSIHydrophilic
58-86NNKVSKWEPSKKEKQHKKKEHKDDQESPVBasic
106-129PYAGPKPRRERAPKKTTQQQQQSQHydrophilic
NLS Segment(s)
PositionSequence
66-78PSKKEKQHKKKEH
102-120KSKGPYAGPKPRRERAPKK
Subcellular Location(s) mito_nucl 12.999, mito 12.5, nucl 12, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR003892  CUE  
IPR009060  UBA-like_sf  
Gene Ontology GO:0043130  F:ubiquitin binding  
KEGG spaa:SPAPADRAFT_62617  -  
Pfam View protein in Pfam  
PF02845  CUE  
PROSITE View protein in PROSITE  
PS51140  CUE  
Amino Acid Sequences MSTQQRKIYKNQSKRFNTPSIELTNLLEMFPDWESEDLQSLLQEHDNSLEVVIDLIVNNKVSKWEPSKKEKQHKKKEHKDDQESPVNNASPANNTASSKQSKSKGPYAGPKPRRERAPKKTTQQQQQSQPTSAGSVSSSTTATAPVASTSPVSNSWASALSSDKPKQEIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.78
4 0.72
5 0.65
6 0.62
7 0.56
8 0.5
9 0.42
10 0.36
11 0.32
12 0.28
13 0.23
14 0.17
15 0.13
16 0.12
17 0.11
18 0.11
19 0.08
20 0.09
21 0.09
22 0.1
23 0.12
24 0.1
25 0.1
26 0.09
27 0.09
28 0.1
29 0.11
30 0.11
31 0.09
32 0.1
33 0.11
34 0.11
35 0.1
36 0.08
37 0.06
38 0.06
39 0.06
40 0.05
41 0.04
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.09
48 0.1
49 0.15
50 0.21
51 0.3
52 0.36
53 0.45
54 0.55
55 0.63
56 0.73
57 0.79
58 0.82
59 0.85
60 0.89
61 0.91
62 0.92
63 0.93
64 0.92
65 0.91
66 0.89
67 0.85
68 0.8
69 0.77
70 0.67
71 0.57
72 0.49
73 0.39
74 0.31
75 0.24
76 0.18
77 0.12
78 0.12
79 0.13
80 0.12
81 0.12
82 0.14
83 0.18
84 0.21
85 0.21
86 0.25
87 0.27
88 0.31
89 0.35
90 0.4
91 0.41
92 0.42
93 0.49
94 0.53
95 0.6
96 0.62
97 0.66
98 0.67
99 0.68
100 0.73
101 0.75
102 0.76
103 0.76
104 0.79
105 0.79
106 0.8
107 0.84
108 0.83
109 0.83
110 0.82
111 0.79
112 0.79
113 0.8
114 0.75
115 0.67
116 0.59
117 0.49
118 0.41
119 0.33
120 0.23
121 0.14
122 0.11
123 0.1
124 0.1
125 0.1
126 0.09
127 0.1
128 0.1
129 0.09
130 0.09
131 0.08
132 0.08
133 0.09
134 0.09
135 0.1
136 0.09
137 0.11
138 0.12
139 0.15
140 0.14
141 0.14
142 0.15
143 0.16
144 0.15
145 0.15
146 0.17
147 0.18
148 0.26
149 0.29
150 0.31