Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FXH3

Protein Details
Accession I2FXH3   
Localization Confidence Low
Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
378-400PEDTPVVKKKEKKINPRFAHLYTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 21.5, cyto_nucl 13.333, nucl 4, mito_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR002305  aa-tRNA-synth_Ic  
IPR014729  Rossmann-like_a/b/a_fold  
IPR002307  Tyr-tRNA-ligase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004831  F:tyrosine-tRNA ligase activity  
GO:0006437  P:tyrosyl-tRNA aminoacylation  
Pfam View protein in Pfam  
PF00579  tRNA-synt_1b  
Amino Acid Sequences MSSQAKLSAEERYTLITRDLDEVLGSDIIKSILEKDERPLSAYWGTAPTGRPHVGYLVPLTKIADFLRAGVEVKILLADIHAFLDNLKAPIELVRHRVNYYRHVLTAVFKAIGVPTDRLVFVVGSSYQLTEAYNMDNYRLCASVTEHDAKKAGAEVVKQVSSPLLSGLLYPGLQALDEQYLDVDMQFGGVDQRKIFTFAEQYLPKLGYKKRAHLMNAMVPGLKGSKMSSSDNSSKIDFLDTPKDVQKKIADAVCAPGEIEGNGVLGFVRAVLFPIARLRVESESMGTPVQESQGAARSFVGTDAPKGTMFAIVRPEKYGGSLHYSDYSSLEKDYASGAVHPADLKKAVSEAITALLEPVQKLFETDAEFKKAKEDAYPEDTPVVKKKEKKINPRFAHLYTKEEGGTAETEEEALANQKIEEENKAKAKATKKQQQGGSLPAEKEGAKKEPTDKENETFVDATRVGVENVHIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.22
4 0.22
5 0.24
6 0.24
7 0.19
8 0.17
9 0.17
10 0.15
11 0.15
12 0.13
13 0.1
14 0.1
15 0.1
16 0.1
17 0.09
18 0.1
19 0.16
20 0.19
21 0.2
22 0.25
23 0.32
24 0.32
25 0.35
26 0.33
27 0.31
28 0.3
29 0.29
30 0.26
31 0.21
32 0.22
33 0.22
34 0.23
35 0.23
36 0.27
37 0.27
38 0.26
39 0.25
40 0.27
41 0.25
42 0.24
43 0.25
44 0.23
45 0.22
46 0.22
47 0.22
48 0.19
49 0.21
50 0.19
51 0.19
52 0.15
53 0.15
54 0.16
55 0.16
56 0.17
57 0.15
58 0.15
59 0.1
60 0.1
61 0.09
62 0.07
63 0.06
64 0.05
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.07
71 0.1
72 0.11
73 0.11
74 0.11
75 0.1
76 0.1
77 0.13
78 0.17
79 0.18
80 0.22
81 0.27
82 0.29
83 0.31
84 0.38
85 0.38
86 0.41
87 0.45
88 0.42
89 0.36
90 0.35
91 0.35
92 0.31
93 0.31
94 0.26
95 0.19
96 0.16
97 0.16
98 0.15
99 0.16
100 0.15
101 0.13
102 0.12
103 0.13
104 0.13
105 0.13
106 0.14
107 0.11
108 0.09
109 0.1
110 0.09
111 0.09
112 0.09
113 0.09
114 0.09
115 0.09
116 0.09
117 0.08
118 0.09
119 0.09
120 0.12
121 0.11
122 0.13
123 0.14
124 0.14
125 0.15
126 0.14
127 0.13
128 0.11
129 0.13
130 0.15
131 0.19
132 0.24
133 0.23
134 0.24
135 0.25
136 0.23
137 0.21
138 0.2
139 0.17
140 0.12
141 0.13
142 0.15
143 0.18
144 0.18
145 0.17
146 0.16
147 0.15
148 0.13
149 0.12
150 0.09
151 0.06
152 0.06
153 0.06
154 0.07
155 0.07
156 0.06
157 0.06
158 0.06
159 0.05
160 0.05
161 0.05
162 0.05
163 0.06
164 0.06
165 0.06
166 0.05
167 0.05
168 0.06
169 0.05
170 0.05
171 0.03
172 0.04
173 0.03
174 0.04
175 0.06
176 0.08
177 0.09
178 0.09
179 0.1
180 0.1
181 0.13
182 0.14
183 0.12
184 0.13
185 0.14
186 0.2
187 0.2
188 0.2
189 0.19
190 0.2
191 0.19
192 0.22
193 0.23
194 0.27
195 0.3
196 0.35
197 0.38
198 0.42
199 0.43
200 0.42
201 0.43
202 0.37
203 0.36
204 0.31
205 0.25
206 0.2
207 0.19
208 0.15
209 0.12
210 0.07
211 0.06
212 0.08
213 0.1
214 0.12
215 0.14
216 0.19
217 0.23
218 0.25
219 0.26
220 0.24
221 0.22
222 0.2
223 0.19
224 0.15
225 0.13
226 0.16
227 0.15
228 0.16
229 0.21
230 0.23
231 0.22
232 0.24
233 0.23
234 0.2
235 0.23
236 0.22
237 0.19
238 0.17
239 0.19
240 0.16
241 0.14
242 0.12
243 0.09
244 0.07
245 0.06
246 0.06
247 0.04
248 0.04
249 0.04
250 0.04
251 0.03
252 0.03
253 0.03
254 0.03
255 0.03
256 0.03
257 0.04
258 0.04
259 0.04
260 0.05
261 0.07
262 0.09
263 0.08
264 0.09
265 0.11
266 0.12
267 0.13
268 0.13
269 0.12
270 0.12
271 0.13
272 0.12
273 0.1
274 0.09
275 0.08
276 0.09
277 0.07
278 0.07
279 0.07
280 0.13
281 0.14
282 0.14
283 0.14
284 0.13
285 0.13
286 0.13
287 0.15
288 0.08
289 0.1
290 0.11
291 0.11
292 0.11
293 0.11
294 0.11
295 0.13
296 0.12
297 0.13
298 0.2
299 0.21
300 0.22
301 0.23
302 0.24
303 0.2
304 0.21
305 0.21
306 0.15
307 0.18
308 0.19
309 0.18
310 0.2
311 0.2
312 0.19
313 0.2
314 0.19
315 0.14
316 0.14
317 0.13
318 0.1
319 0.1
320 0.1
321 0.1
322 0.08
323 0.08
324 0.09
325 0.09
326 0.1
327 0.1
328 0.1
329 0.11
330 0.12
331 0.11
332 0.1
333 0.1
334 0.11
335 0.1
336 0.1
337 0.09
338 0.09
339 0.09
340 0.09
341 0.08
342 0.09
343 0.1
344 0.09
345 0.09
346 0.08
347 0.08
348 0.09
349 0.09
350 0.11
351 0.15
352 0.2
353 0.23
354 0.28
355 0.29
356 0.28
357 0.31
358 0.3
359 0.26
360 0.25
361 0.27
362 0.27
363 0.34
364 0.35
365 0.32
366 0.34
367 0.35
368 0.33
369 0.36
370 0.37
371 0.36
372 0.42
373 0.51
374 0.59
375 0.67
376 0.75
377 0.79
378 0.83
379 0.82
380 0.83
381 0.8
382 0.73
383 0.74
384 0.66
385 0.6
386 0.5
387 0.47
388 0.38
389 0.32
390 0.28
391 0.2
392 0.18
393 0.14
394 0.12
395 0.1
396 0.1
397 0.09
398 0.09
399 0.07
400 0.09
401 0.09
402 0.08
403 0.08
404 0.1
405 0.12
406 0.14
407 0.21
408 0.22
409 0.28
410 0.34
411 0.37
412 0.38
413 0.43
414 0.49
415 0.51
416 0.59
417 0.62
418 0.65
419 0.7
420 0.72
421 0.75
422 0.71
423 0.68
424 0.66
425 0.62
426 0.53
427 0.46
428 0.43
429 0.35
430 0.35
431 0.34
432 0.32
433 0.28
434 0.32
435 0.39
436 0.47
437 0.5
438 0.55
439 0.55
440 0.53
441 0.56
442 0.53
443 0.49
444 0.41
445 0.37
446 0.34
447 0.28
448 0.25
449 0.22
450 0.21
451 0.17
452 0.17