Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FZL1

Protein Details
Accession I2FZL1   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
226-247ALKQRLQRIKQARLEKQKAAKKHydrophilic
NLS Segment(s)
PositionSequence
235-248KQARLEKQKAAKKA
Subcellular Location(s) nucl 20.5, mito_nucl 12.5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040050  ZNF830-like  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MPEDARSLLRAAAKERAKSKASIISDRFASYSSTGSLRCSACNYLTIKHESLWGAHALSKSHRANLTRIREEELRQAELQRTKEGKRKADETDADLDEGDGPQPSGLNRDADEGEAAPESKKARTGASIDPEWELFKTQMEAAEEEQPNQTTNNYSAGAALEAEAQLILQDGTEGQAAGEAEQEKSKEEMEALETARKEQEEREEILSRLEEEQRQQDEADQRVSALKQRLQRIKQARLEKQKAAKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.47
4 0.45
5 0.45
6 0.46
7 0.46
8 0.46
9 0.49
10 0.47
11 0.45
12 0.44
13 0.43
14 0.39
15 0.31
16 0.28
17 0.19
18 0.18
19 0.16
20 0.16
21 0.16
22 0.18
23 0.22
24 0.21
25 0.21
26 0.23
27 0.24
28 0.23
29 0.27
30 0.27
31 0.25
32 0.29
33 0.32
34 0.3
35 0.27
36 0.3
37 0.25
38 0.24
39 0.22
40 0.19
41 0.15
42 0.17
43 0.17
44 0.16
45 0.17
46 0.25
47 0.24
48 0.27
49 0.31
50 0.3
51 0.36
52 0.44
53 0.5
54 0.47
55 0.47
56 0.48
57 0.46
58 0.46
59 0.47
60 0.41
61 0.35
62 0.3
63 0.31
64 0.32
65 0.34
66 0.34
67 0.32
68 0.33
69 0.34
70 0.41
71 0.46
72 0.47
73 0.46
74 0.49
75 0.46
76 0.5
77 0.47
78 0.44
79 0.42
80 0.36
81 0.31
82 0.27
83 0.23
84 0.15
85 0.14
86 0.1
87 0.05
88 0.04
89 0.04
90 0.05
91 0.05
92 0.07
93 0.08
94 0.09
95 0.09
96 0.11
97 0.12
98 0.11
99 0.12
100 0.09
101 0.08
102 0.08
103 0.08
104 0.06
105 0.08
106 0.08
107 0.08
108 0.11
109 0.11
110 0.11
111 0.13
112 0.17
113 0.19
114 0.22
115 0.22
116 0.2
117 0.2
118 0.19
119 0.18
120 0.14
121 0.12
122 0.08
123 0.07
124 0.07
125 0.07
126 0.09
127 0.09
128 0.1
129 0.11
130 0.18
131 0.18
132 0.18
133 0.19
134 0.17
135 0.17
136 0.16
137 0.15
138 0.09
139 0.1
140 0.12
141 0.12
142 0.12
143 0.11
144 0.11
145 0.11
146 0.09
147 0.08
148 0.06
149 0.05
150 0.05
151 0.04
152 0.04
153 0.03
154 0.04
155 0.03
156 0.02
157 0.03
158 0.03
159 0.04
160 0.04
161 0.04
162 0.04
163 0.05
164 0.06
165 0.06
166 0.08
167 0.08
168 0.09
169 0.11
170 0.11
171 0.11
172 0.12
173 0.13
174 0.11
175 0.1
176 0.11
177 0.12
178 0.14
179 0.14
180 0.17
181 0.17
182 0.18
183 0.2
184 0.19
185 0.18
186 0.18
187 0.25
188 0.25
189 0.28
190 0.32
191 0.33
192 0.33
193 0.34
194 0.32
195 0.25
196 0.24
197 0.25
198 0.22
199 0.23
200 0.3
201 0.3
202 0.31
203 0.3
204 0.33
205 0.35
206 0.36
207 0.35
208 0.27
209 0.25
210 0.27
211 0.28
212 0.29
213 0.29
214 0.31
215 0.35
216 0.45
217 0.55
218 0.55
219 0.64
220 0.67
221 0.7
222 0.74
223 0.78
224 0.78
225 0.8
226 0.83
227 0.81
228 0.82