Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K3QCW5

Protein Details
Accession A0A2K3QCW5   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26TGEDKQRRSYRQRSARNRHNLRPLPVHydrophilic
57-87RQRNAQRDPRLPRRPRPRAARKQKRWSGDNABasic
NLS Segment(s)
PositionSequence
54-84PTLRQRNAQRDPRLPRRPRPRAARKQKRWSG
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences TGEDKQRRSYRQRSARNRHNLRPLPVKRHRTGEGTDDSEDEYVLALKRLKAAAPTLRQRNAQRDPRLPRRPRPRAARKQKRWSGDNASSANKRRLPALPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.91
4 0.9
5 0.87
6 0.88
7 0.83
8 0.79
9 0.79
10 0.76
11 0.75
12 0.76
13 0.76
14 0.69
15 0.69
16 0.65
17 0.58
18 0.54
19 0.49
20 0.44
21 0.39
22 0.36
23 0.29
24 0.27
25 0.22
26 0.2
27 0.14
28 0.08
29 0.06
30 0.06
31 0.07
32 0.07
33 0.07
34 0.09
35 0.09
36 0.09
37 0.1
38 0.13
39 0.17
40 0.22
41 0.29
42 0.34
43 0.36
44 0.41
45 0.44
46 0.49
47 0.52
48 0.55
49 0.55
50 0.58
51 0.64
52 0.7
53 0.77
54 0.75
55 0.77
56 0.79
57 0.82
58 0.82
59 0.84
60 0.85
61 0.86
62 0.9
63 0.92
64 0.91
65 0.93
66 0.91
67 0.89
68 0.81
69 0.78
70 0.76
71 0.72
72 0.68
73 0.61
74 0.6
75 0.59
76 0.61
77 0.61
78 0.55
79 0.48
80 0.46