Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AHS8

Protein Details
Accession G3AHS8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
121-145TSNDTSYRPPKPKNRSKINCSFCGEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG spaa:SPAPADRAFT_59671  -  
Pfam View protein in Pfam  
PF16588  zf-C2H2_10  
Amino Acid Sequences MSIVELSATVDKLAKIINQKNKQLEDLKQGYDQKLHIINEYIRTLEGSIEGDSSKESIPNEEFIKKISSKVECPNCKHVIWDNMQSGEYVLVPKHQLKYLIRDTPQAQTQAHEPITPTTSTSNDTSYRPPKPKNRSKINCSFCGEPGHTRAKCYKRLTTPKEETGNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.22
3 0.3
4 0.4
5 0.47
6 0.55
7 0.61
8 0.62
9 0.64
10 0.61
11 0.57
12 0.56
13 0.52
14 0.48
15 0.46
16 0.48
17 0.44
18 0.41
19 0.36
20 0.31
21 0.33
22 0.31
23 0.26
24 0.26
25 0.26
26 0.27
27 0.28
28 0.23
29 0.18
30 0.17
31 0.16
32 0.13
33 0.12
34 0.09
35 0.08
36 0.08
37 0.08
38 0.08
39 0.08
40 0.09
41 0.08
42 0.08
43 0.08
44 0.11
45 0.12
46 0.15
47 0.17
48 0.17
49 0.17
50 0.17
51 0.21
52 0.18
53 0.19
54 0.21
55 0.21
56 0.23
57 0.32
58 0.4
59 0.42
60 0.46
61 0.51
62 0.49
63 0.47
64 0.45
65 0.41
66 0.37
67 0.34
68 0.35
69 0.29
70 0.26
71 0.26
72 0.24
73 0.2
74 0.14
75 0.11
76 0.07
77 0.06
78 0.06
79 0.08
80 0.1
81 0.12
82 0.13
83 0.17
84 0.18
85 0.25
86 0.31
87 0.34
88 0.33
89 0.35
90 0.36
91 0.35
92 0.36
93 0.32
94 0.26
95 0.22
96 0.23
97 0.24
98 0.23
99 0.2
100 0.18
101 0.16
102 0.18
103 0.17
104 0.16
105 0.13
106 0.14
107 0.16
108 0.17
109 0.18
110 0.18
111 0.2
112 0.27
113 0.32
114 0.4
115 0.44
116 0.52
117 0.59
118 0.68
119 0.76
120 0.78
121 0.83
122 0.84
123 0.86
124 0.88
125 0.85
126 0.81
127 0.76
128 0.68
129 0.59
130 0.56
131 0.5
132 0.43
133 0.42
134 0.45
135 0.4
136 0.42
137 0.49
138 0.49
139 0.55
140 0.58
141 0.61
142 0.62
143 0.73
144 0.77
145 0.78
146 0.79
147 0.79