Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2G399

Protein Details
Accession I2G399    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-31QVRKAHRNGIKKPKTNKYPSHydrophilic
NLS Segment(s)
PositionSequence
15-28KAHRNGIKKPKTNK
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQVRKAHRNGIKKPKTNKYPSLRGVDPKFVRNQRYAKHGTEKALKAARAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.77
4 0.75
5 0.75
6 0.76
7 0.79
8 0.78
9 0.77
10 0.79
11 0.79
12 0.81
13 0.79
14 0.79
15 0.75
16 0.74
17 0.71
18 0.68
19 0.6
20 0.57
21 0.53
22 0.52
23 0.46
24 0.41
25 0.44
26 0.44
27 0.45
28 0.46
29 0.49
30 0.44
31 0.51
32 0.53
33 0.5
34 0.54
35 0.54
36 0.54
37 0.56
38 0.55
39 0.55
40 0.55
41 0.51