Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2G461

Protein Details
Accession I2G461    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
269-292SDLSNKKKPRLLRKKAARPPLPSLHydrophilic
344-367ALSFRFKMLRAKRKVKRSGQGAVDHydrophilic
NLS Segment(s)
PositionSequence
274-287KKKPRLLRKKAARP
353-360RAKRKVKR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MTPILGASGLGRCGRSTQASTLDLSSSSSSSRRHSSSSQARKSSHTSSLMDDWSDAFTGIVDLDRRMRQLAMSEQGLEPLDSSTQLDVYEPYSPLSPSRLESLQHVHSRRKSSTDARSGSISQPSLTTGRSFPSFTSHPTNTTASSSSTTATWRFSQDSRAHSSSLLAKRRSSATSTIDSFDSTHSPIRLAPLPASPSAFGNYRLTDSTSLPRTRLMLPATCWSSLDEQDPLTPLAIPSSQLDPITPTTAAAATWTDPTAPSYFPAGLSDLSNKKKPRLLRKKAARPPLPSLVSAQVVSSPTAESGLVGDDRDRLQVAVTLPANMGKDESGRAYTLRRSAQSLALSFRFKMLRAKRKVKRSGQGAVDLFAAAASQTSSGEATSISI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.25
4 0.27
5 0.31
6 0.33
7 0.34
8 0.33
9 0.3
10 0.25
11 0.24
12 0.2
13 0.15
14 0.16
15 0.18
16 0.2
17 0.24
18 0.3
19 0.31
20 0.35
21 0.37
22 0.46
23 0.53
24 0.61
25 0.65
26 0.66
27 0.65
28 0.65
29 0.68
30 0.63
31 0.59
32 0.54
33 0.46
34 0.44
35 0.46
36 0.42
37 0.36
38 0.31
39 0.25
40 0.2
41 0.19
42 0.14
43 0.09
44 0.08
45 0.07
46 0.07
47 0.08
48 0.08
49 0.09
50 0.14
51 0.16
52 0.17
53 0.18
54 0.18
55 0.17
56 0.21
57 0.24
58 0.24
59 0.24
60 0.25
61 0.23
62 0.25
63 0.24
64 0.2
65 0.15
66 0.11
67 0.1
68 0.09
69 0.1
70 0.08
71 0.08
72 0.08
73 0.08
74 0.08
75 0.1
76 0.12
77 0.11
78 0.12
79 0.13
80 0.13
81 0.14
82 0.16
83 0.15
84 0.14
85 0.18
86 0.19
87 0.18
88 0.21
89 0.26
90 0.3
91 0.35
92 0.38
93 0.42
94 0.46
95 0.51
96 0.5
97 0.49
98 0.48
99 0.5
100 0.55
101 0.56
102 0.53
103 0.49
104 0.5
105 0.47
106 0.43
107 0.39
108 0.3
109 0.21
110 0.19
111 0.19
112 0.17
113 0.16
114 0.15
115 0.12
116 0.14
117 0.15
118 0.16
119 0.14
120 0.18
121 0.19
122 0.21
123 0.27
124 0.26
125 0.27
126 0.29
127 0.3
128 0.26
129 0.27
130 0.24
131 0.18
132 0.19
133 0.17
134 0.14
135 0.13
136 0.14
137 0.13
138 0.15
139 0.15
140 0.15
141 0.17
142 0.17
143 0.24
144 0.27
145 0.3
146 0.34
147 0.34
148 0.33
149 0.3
150 0.31
151 0.31
152 0.34
153 0.37
154 0.32
155 0.31
156 0.32
157 0.35
158 0.35
159 0.3
160 0.27
161 0.24
162 0.25
163 0.26
164 0.25
165 0.23
166 0.22
167 0.19
168 0.16
169 0.14
170 0.11
171 0.12
172 0.11
173 0.11
174 0.11
175 0.13
176 0.14
177 0.14
178 0.13
179 0.14
180 0.15
181 0.15
182 0.16
183 0.13
184 0.11
185 0.12
186 0.12
187 0.12
188 0.12
189 0.12
190 0.13
191 0.13
192 0.14
193 0.14
194 0.15
195 0.17
196 0.21
197 0.22
198 0.21
199 0.21
200 0.22
201 0.22
202 0.24
203 0.22
204 0.18
205 0.19
206 0.24
207 0.25
208 0.23
209 0.22
210 0.19
211 0.19
212 0.18
213 0.17
214 0.14
215 0.12
216 0.12
217 0.13
218 0.12
219 0.1
220 0.09
221 0.07
222 0.08
223 0.07
224 0.08
225 0.08
226 0.1
227 0.11
228 0.1
229 0.11
230 0.11
231 0.13
232 0.14
233 0.12
234 0.1
235 0.1
236 0.1
237 0.1
238 0.08
239 0.08
240 0.07
241 0.08
242 0.08
243 0.07
244 0.07
245 0.1
246 0.1
247 0.1
248 0.1
249 0.11
250 0.12
251 0.12
252 0.13
253 0.12
254 0.11
255 0.12
256 0.17
257 0.21
258 0.25
259 0.32
260 0.33
261 0.36
262 0.4
263 0.46
264 0.52
265 0.57
266 0.63
267 0.68
268 0.77
269 0.84
270 0.88
271 0.9
272 0.86
273 0.81
274 0.77
275 0.75
276 0.66
277 0.56
278 0.5
279 0.43
280 0.37
281 0.31
282 0.24
283 0.17
284 0.16
285 0.16
286 0.14
287 0.11
288 0.09
289 0.1
290 0.1
291 0.07
292 0.07
293 0.08
294 0.08
295 0.08
296 0.08
297 0.1
298 0.11
299 0.12
300 0.12
301 0.1
302 0.1
303 0.13
304 0.14
305 0.18
306 0.18
307 0.17
308 0.17
309 0.2
310 0.2
311 0.16
312 0.16
313 0.11
314 0.12
315 0.13
316 0.15
317 0.14
318 0.14
319 0.16
320 0.18
321 0.23
322 0.28
323 0.31
324 0.31
325 0.34
326 0.35
327 0.39
328 0.41
329 0.38
330 0.37
331 0.36
332 0.37
333 0.33
334 0.35
335 0.31
336 0.28
337 0.35
338 0.4
339 0.46
340 0.55
341 0.65
342 0.69
343 0.79
344 0.87
345 0.87
346 0.86
347 0.84
348 0.82
349 0.77
350 0.77
351 0.67
352 0.58
353 0.49
354 0.39
355 0.31
356 0.22
357 0.16
358 0.07
359 0.06
360 0.05
361 0.05
362 0.05
363 0.06
364 0.07
365 0.07
366 0.07