Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AMF8

Protein Details
Accession G3AMF8    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MARSSVRKNTRRTKNKQRNINIHSNPIHydrophilic
133-153LQEYGKKHSQIKKVRHQSSREHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
KEGG spaa:SPAPADRAFT_60155  -  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MARSSVRKNTRRTKNKQRNINIHSNPIIAANWDKSLTLQQNYKRLGLRAKLGSLAGGVEQSVESLTEIREKRDKNEQETNEVEDTDDPAKIPVGQAKIIRDETTNEVIKVIYGEKKAEDKLATAEESEVVKQLQEYGKKHSQIKKVRHQSSREDEWLRSLYEKYGDDYEKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.92
4 0.92
5 0.91
6 0.88
7 0.89
8 0.81
9 0.77
10 0.69
11 0.59
12 0.49
13 0.39
14 0.31
15 0.22
16 0.21
17 0.16
18 0.15
19 0.15
20 0.15
21 0.14
22 0.21
23 0.23
24 0.24
25 0.29
26 0.33
27 0.4
28 0.43
29 0.45
30 0.41
31 0.39
32 0.41
33 0.38
34 0.39
35 0.34
36 0.33
37 0.3
38 0.28
39 0.25
40 0.19
41 0.16
42 0.09
43 0.07
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.11
54 0.12
55 0.15
56 0.21
57 0.22
58 0.25
59 0.35
60 0.39
61 0.39
62 0.47
63 0.46
64 0.45
65 0.46
66 0.46
67 0.36
68 0.31
69 0.25
70 0.16
71 0.16
72 0.12
73 0.1
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.08
80 0.09
81 0.12
82 0.14
83 0.15
84 0.18
85 0.19
86 0.19
87 0.17
88 0.17
89 0.19
90 0.22
91 0.22
92 0.19
93 0.18
94 0.17
95 0.16
96 0.15
97 0.13
98 0.11
99 0.12
100 0.12
101 0.14
102 0.17
103 0.18
104 0.2
105 0.18
106 0.15
107 0.17
108 0.18
109 0.17
110 0.14
111 0.14
112 0.13
113 0.13
114 0.13
115 0.11
116 0.09
117 0.09
118 0.08
119 0.12
120 0.16
121 0.21
122 0.23
123 0.3
124 0.38
125 0.43
126 0.51
127 0.55
128 0.6
129 0.63
130 0.7
131 0.73
132 0.77
133 0.81
134 0.82
135 0.79
136 0.79
137 0.78
138 0.77
139 0.74
140 0.66
141 0.58
142 0.55
143 0.52
144 0.44
145 0.37
146 0.3
147 0.25
148 0.27
149 0.27
150 0.25
151 0.3