Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FMY7

Protein Details
Accession I2FMY7    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MTRTRHGKKTHHARRDVKRGMRTRABasic
NLS Segment(s)
PositionSequence
6-24HGKKTHHARRDVKRGMRTR
88-89RR
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MTRTRHGKKTHHARRDVKRGMRTRAMKLHPDQIQANLKDPKKLEALQNPKELDVEKAGLGLFYCVECDRHFPSQKDQLSHMASKLHKRRAKKITEEPAYTIEESLRAVGIRIDNRQRTSKPAEEPVQEMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.88
4 0.85
5 0.84
6 0.82
7 0.8
8 0.8
9 0.75
10 0.71
11 0.71
12 0.67
13 0.65
14 0.61
15 0.61
16 0.55
17 0.54
18 0.47
19 0.45
20 0.47
21 0.41
22 0.44
23 0.43
24 0.4
25 0.41
26 0.4
27 0.36
28 0.33
29 0.34
30 0.34
31 0.36
32 0.45
33 0.46
34 0.51
35 0.48
36 0.44
37 0.42
38 0.36
39 0.28
40 0.2
41 0.16
42 0.1
43 0.1
44 0.09
45 0.09
46 0.08
47 0.06
48 0.05
49 0.04
50 0.05
51 0.04
52 0.06
53 0.06
54 0.09
55 0.13
56 0.19
57 0.23
58 0.25
59 0.3
60 0.38
61 0.41
62 0.4
63 0.38
64 0.38
65 0.37
66 0.36
67 0.32
68 0.28
69 0.27
70 0.35
71 0.4
72 0.44
73 0.45
74 0.49
75 0.58
76 0.62
77 0.68
78 0.68
79 0.71
80 0.71
81 0.74
82 0.71
83 0.64
84 0.57
85 0.52
86 0.43
87 0.33
88 0.23
89 0.16
90 0.15
91 0.13
92 0.1
93 0.07
94 0.07
95 0.09
96 0.14
97 0.17
98 0.23
99 0.32
100 0.38
101 0.42
102 0.49
103 0.48
104 0.51
105 0.56
106 0.55
107 0.53
108 0.56
109 0.58
110 0.54