Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FSB8

Protein Details
Accession I2FSB8    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
238-267GDAEEDKAEKRRRKAQKKAKKKCKDCSFAGBasic
NLS Segment(s)
PositionSequence
213-229KRRAEEKANKKKAKART
244-259KAEKRRRKAQKKAKKK
Subcellular Location(s) nucl 21, cyto_nucl 13.833, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR027799  Rtf2_RING-finger  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
Pfam View protein in Pfam  
PF04641  Rtf2  
CDD cd16653  RING-like_Rtf2  
Amino Acid Sequences MGNDGGSIAKRDELVRTKPSSEKVDPELLRQSLYTVCTLSRQPLTPPVASDPLGKLYNKDAVVQHLLSHHAISSSSPSAPDPTPHIRGLRDIVELKLTPNNLYRPPSPSSPTSEGSVYPFMCPLSRKQMDGKQKFVYIASCGCAMSATGLKATVAASKGNDGKEEEYRPCPVCGKQFNAGGLAKGKQAEVGGDVVTINPSAEEEAEMRDVMEKRRAEEKANKKKAKARTADEAEAPNGDAEEDKAEKRRRKAQKKAKKKCKDCSFAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.42
4 0.45
5 0.49
6 0.54
7 0.55
8 0.51
9 0.51
10 0.48
11 0.54
12 0.5
13 0.5
14 0.5
15 0.43
16 0.39
17 0.34
18 0.3
19 0.23
20 0.24
21 0.21
22 0.14
23 0.14
24 0.16
25 0.18
26 0.21
27 0.22
28 0.22
29 0.23
30 0.3
31 0.34
32 0.32
33 0.33
34 0.32
35 0.32
36 0.32
37 0.31
38 0.25
39 0.25
40 0.27
41 0.25
42 0.22
43 0.22
44 0.27
45 0.25
46 0.26
47 0.23
48 0.24
49 0.28
50 0.26
51 0.24
52 0.2
53 0.22
54 0.19
55 0.18
56 0.14
57 0.1
58 0.1
59 0.1
60 0.13
61 0.12
62 0.12
63 0.12
64 0.13
65 0.16
66 0.16
67 0.17
68 0.19
69 0.23
70 0.26
71 0.28
72 0.3
73 0.27
74 0.29
75 0.3
76 0.26
77 0.24
78 0.21
79 0.19
80 0.19
81 0.19
82 0.18
83 0.18
84 0.16
85 0.15
86 0.17
87 0.2
88 0.2
89 0.24
90 0.24
91 0.26
92 0.29
93 0.3
94 0.3
95 0.29
96 0.32
97 0.33
98 0.33
99 0.3
100 0.27
101 0.25
102 0.24
103 0.25
104 0.18
105 0.14
106 0.13
107 0.12
108 0.12
109 0.13
110 0.13
111 0.19
112 0.2
113 0.21
114 0.25
115 0.32
116 0.42
117 0.44
118 0.47
119 0.39
120 0.39
121 0.38
122 0.34
123 0.27
124 0.18
125 0.15
126 0.12
127 0.1
128 0.09
129 0.08
130 0.08
131 0.07
132 0.07
133 0.07
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.07
140 0.07
141 0.07
142 0.07
143 0.08
144 0.11
145 0.14
146 0.14
147 0.14
148 0.14
149 0.16
150 0.19
151 0.22
152 0.22
153 0.22
154 0.26
155 0.26
156 0.26
157 0.26
158 0.25
159 0.3
160 0.31
161 0.33
162 0.34
163 0.35
164 0.34
165 0.36
166 0.33
167 0.27
168 0.24
169 0.21
170 0.17
171 0.15
172 0.15
173 0.12
174 0.11
175 0.1
176 0.09
177 0.09
178 0.08
179 0.07
180 0.08
181 0.07
182 0.07
183 0.07
184 0.05
185 0.04
186 0.04
187 0.05
188 0.05
189 0.06
190 0.06
191 0.08
192 0.09
193 0.09
194 0.09
195 0.13
196 0.15
197 0.17
198 0.24
199 0.23
200 0.25
201 0.33
202 0.35
203 0.37
204 0.46
205 0.54
206 0.58
207 0.68
208 0.71
209 0.69
210 0.75
211 0.78
212 0.78
213 0.75
214 0.7
215 0.7
216 0.71
217 0.69
218 0.65
219 0.57
220 0.48
221 0.4
222 0.35
223 0.24
224 0.17
225 0.13
226 0.1
227 0.08
228 0.12
229 0.13
230 0.16
231 0.24
232 0.34
233 0.41
234 0.48
235 0.58
236 0.65
237 0.74
238 0.82
239 0.85
240 0.87
241 0.91
242 0.95
243 0.96
244 0.96
245 0.95
246 0.95
247 0.94