Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FUC0

Protein Details
Accession I2FUC0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKELLKKRRRVRLYTLEPRALHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MKELLKKRRRVRLYTLEPRALVQRLPKVDGVEVAKSVGGPLDRDLISIMTYRYSSFFVIGGNGKVRDFDRKPESNSYTWADKLEPKVLEAVKAAHGAPEPTVSILARQVGPAEDAAVASSRSLSRKLTEGVKSVLERVTSTLTSSRAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.75
4 0.67
5 0.62
6 0.56
7 0.47
8 0.38
9 0.34
10 0.33
11 0.31
12 0.34
13 0.34
14 0.31
15 0.3
16 0.32
17 0.29
18 0.23
19 0.21
20 0.18
21 0.16
22 0.14
23 0.13
24 0.11
25 0.08
26 0.07
27 0.08
28 0.12
29 0.12
30 0.12
31 0.13
32 0.11
33 0.11
34 0.12
35 0.11
36 0.08
37 0.08
38 0.09
39 0.09
40 0.1
41 0.1
42 0.1
43 0.1
44 0.09
45 0.1
46 0.11
47 0.11
48 0.11
49 0.12
50 0.11
51 0.12
52 0.12
53 0.18
54 0.18
55 0.24
56 0.29
57 0.32
58 0.35
59 0.41
60 0.44
61 0.37
62 0.39
63 0.35
64 0.3
65 0.27
66 0.25
67 0.19
68 0.18
69 0.2
70 0.21
71 0.19
72 0.17
73 0.21
74 0.2
75 0.19
76 0.17
77 0.16
78 0.13
79 0.14
80 0.13
81 0.1
82 0.11
83 0.1
84 0.1
85 0.09
86 0.08
87 0.07
88 0.08
89 0.07
90 0.08
91 0.09
92 0.1
93 0.09
94 0.09
95 0.09
96 0.09
97 0.1
98 0.09
99 0.09
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.06
106 0.08
107 0.09
108 0.11
109 0.13
110 0.15
111 0.16
112 0.2
113 0.24
114 0.29
115 0.31
116 0.33
117 0.33
118 0.36
119 0.35
120 0.34
121 0.32
122 0.26
123 0.23
124 0.22
125 0.24
126 0.19
127 0.21
128 0.22