Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FPX7

Protein Details
Accession I2FPX7    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-24FKPAKPKKAASPKKSSSQTKHydrophilic
NLS Segment(s)
PositionSequence
6-47KPAKPKKAASPKKSSSQTKTGPKRGPRVIAPKKKAAVQAAKT
Subcellular Location(s) nucl 20, cyto 4, mito 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGFKPAKPKKAASPKKSSSQTKTGPKRGPRVIAPKKKAAVQAAKTKRQQTGAITARIEQEMVSRASKGGPLTIMNKAADGDAHDNKKNLNKKNLNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.76
3 0.75
4 0.77
5 0.82
6 0.79
7 0.74
8 0.73
9 0.73
10 0.73
11 0.77
12 0.76
13 0.75
14 0.74
15 0.76
16 0.73
17 0.69
18 0.65
19 0.66
20 0.68
21 0.7
22 0.67
23 0.65
24 0.61
25 0.6
26 0.57
27 0.52
28 0.49
29 0.44
30 0.5
31 0.5
32 0.56
33 0.56
34 0.56
35 0.52
36 0.46
37 0.43
38 0.35
39 0.38
40 0.35
41 0.33
42 0.3
43 0.29
44 0.28
45 0.25
46 0.23
47 0.13
48 0.11
49 0.1
50 0.12
51 0.11
52 0.1
53 0.11
54 0.11
55 0.13
56 0.12
57 0.11
58 0.1
59 0.12
60 0.15
61 0.18
62 0.2
63 0.18
64 0.18
65 0.18
66 0.16
67 0.14
68 0.15
69 0.18
70 0.22
71 0.27
72 0.29
73 0.3
74 0.34
75 0.42
76 0.47
77 0.5
78 0.54
79 0.59