Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FWE6

Protein Details
Accession I2FWE6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
129-151VESPLKVNKKPLRPRAGRKLVEKHydrophilic
NLS Segment(s)
PositionSequence
137-147KKPLRPRAGRK
Subcellular Location(s) mito 25.5, cyto_mito 13.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR007740  Ribosomal_L49/IMG2  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05046  Img2  
Amino Acid Sequences MASLVRKNLRSALRYASSSSAPVASSSKVQLTPTLARYNSTSSTPSSSEPTPSEEPSSNGPTSVKYSYFVPRVGKTLDSFPVYTDIRNGGTRTITELRKIQGSIEDLKTDLSVFLAETYATADPELNNVESPLKVNKKPLRPRAGRKLVEKTGNPTYMDPVQTGKVQESGKLKIRGNRVEEVKAFLKSRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.38
4 0.33
5 0.31
6 0.28
7 0.22
8 0.17
9 0.17
10 0.16
11 0.14
12 0.15
13 0.16
14 0.18
15 0.19
16 0.19
17 0.2
18 0.23
19 0.27
20 0.29
21 0.33
22 0.3
23 0.3
24 0.32
25 0.33
26 0.3
27 0.27
28 0.25
29 0.2
30 0.24
31 0.24
32 0.23
33 0.23
34 0.22
35 0.23
36 0.23
37 0.27
38 0.27
39 0.27
40 0.29
41 0.26
42 0.27
43 0.28
44 0.31
45 0.25
46 0.23
47 0.21
48 0.19
49 0.22
50 0.22
51 0.18
52 0.15
53 0.17
54 0.22
55 0.24
56 0.26
57 0.25
58 0.24
59 0.26
60 0.26
61 0.25
62 0.21
63 0.21
64 0.21
65 0.19
66 0.18
67 0.16
68 0.19
69 0.18
70 0.17
71 0.15
72 0.13
73 0.13
74 0.14
75 0.14
76 0.11
77 0.11
78 0.11
79 0.15
80 0.18
81 0.17
82 0.18
83 0.19
84 0.19
85 0.2
86 0.2
87 0.16
88 0.14
89 0.16
90 0.17
91 0.16
92 0.16
93 0.14
94 0.14
95 0.14
96 0.11
97 0.09
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.08
112 0.09
113 0.08
114 0.08
115 0.08
116 0.09
117 0.09
118 0.11
119 0.17
120 0.21
121 0.22
122 0.32
123 0.39
124 0.48
125 0.58
126 0.66
127 0.69
128 0.73
129 0.81
130 0.82
131 0.86
132 0.81
133 0.79
134 0.78
135 0.74
136 0.72
137 0.65
138 0.6
139 0.56
140 0.54
141 0.48
142 0.4
143 0.38
144 0.34
145 0.33
146 0.28
147 0.23
148 0.22
149 0.23
150 0.23
151 0.2
152 0.22
153 0.21
154 0.26
155 0.28
156 0.32
157 0.38
158 0.44
159 0.46
160 0.47
161 0.55
162 0.58
163 0.59
164 0.61
165 0.57
166 0.57
167 0.54
168 0.54
169 0.48
170 0.45
171 0.42