Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AFR0

Protein Details
Accession G3AFR0    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAAANSNKKANRRSRKKRRTEDFSSSSEHydrophilic
NLS Segment(s)
PositionSequence
8-19KKANRRSRKKRR
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
KEGG spaa:SPAPADRAFT_48100  -  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MAAANSNKKANRRSRKKRRTEDFSSSSESSSSESESEAQVEQTTEDVELKDNQANINIDDIEIDSDSEKPSHRAPEKLSLTQKEQLKNIPFTTTPISNLTTSSTNSIANINQVSSGIDEQKKNLQNQYLKLMASEFSDDLDELRKKPDFTDKSLVILAKTLQSGVNMFDPETLANVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.9
3 0.94
4 0.95
5 0.95
6 0.93
7 0.91
8 0.89
9 0.83
10 0.76
11 0.72
12 0.62
13 0.52
14 0.43
15 0.35
16 0.26
17 0.21
18 0.19
19 0.12
20 0.12
21 0.12
22 0.12
23 0.13
24 0.12
25 0.11
26 0.1
27 0.1
28 0.09
29 0.08
30 0.08
31 0.07
32 0.08
33 0.08
34 0.09
35 0.1
36 0.12
37 0.13
38 0.14
39 0.13
40 0.16
41 0.17
42 0.15
43 0.16
44 0.13
45 0.11
46 0.11
47 0.11
48 0.08
49 0.07
50 0.07
51 0.05
52 0.06
53 0.07
54 0.08
55 0.08
56 0.1
57 0.12
58 0.2
59 0.22
60 0.25
61 0.27
62 0.36
63 0.39
64 0.43
65 0.46
66 0.41
67 0.42
68 0.44
69 0.45
70 0.38
71 0.35
72 0.34
73 0.33
74 0.33
75 0.3
76 0.26
77 0.22
78 0.22
79 0.23
80 0.18
81 0.16
82 0.16
83 0.17
84 0.15
85 0.16
86 0.15
87 0.14
88 0.14
89 0.14
90 0.13
91 0.11
92 0.12
93 0.13
94 0.11
95 0.12
96 0.11
97 0.09
98 0.08
99 0.08
100 0.08
101 0.08
102 0.09
103 0.12
104 0.15
105 0.15
106 0.17
107 0.24
108 0.29
109 0.3
110 0.33
111 0.36
112 0.37
113 0.39
114 0.43
115 0.38
116 0.33
117 0.31
118 0.28
119 0.21
120 0.18
121 0.17
122 0.12
123 0.1
124 0.11
125 0.1
126 0.1
127 0.16
128 0.17
129 0.15
130 0.2
131 0.22
132 0.22
133 0.25
134 0.35
135 0.33
136 0.38
137 0.46
138 0.42
139 0.43
140 0.45
141 0.43
142 0.33
143 0.3
144 0.24
145 0.18
146 0.17
147 0.15
148 0.13
149 0.13
150 0.14
151 0.15
152 0.17
153 0.15
154 0.15
155 0.15
156 0.15
157 0.14