Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FZP1

Protein Details
Accession I2FZP1   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
17-37WKNPWRLSSTRKNRVRMRLRAHydrophilic
78-105KHDRGFRKSVHKVPKWTRKTIRENPVGYBasic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTLPSMGGLLWKNPWRLSSTRKNRVRMRLRAVDDVISTLQQSQIQCGALERALALPTESQMAAKDKYTTFSKHDRGFRKSVHKVPKWTRKTIRENPVGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.22
4 0.26
5 0.27
6 0.27
7 0.27
8 0.27
9 0.31
10 0.38
11 0.43
12 0.49
13 0.57
14 0.64
15 0.71
16 0.74
17 0.81
18 0.82
19 0.79
20 0.77
21 0.75
22 0.72
23 0.67
24 0.6
25 0.51
26 0.41
27 0.33
28 0.25
29 0.17
30 0.13
31 0.09
32 0.08
33 0.09
34 0.09
35 0.09
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.07
42 0.07
43 0.06
44 0.05
45 0.05
46 0.05
47 0.06
48 0.05
49 0.05
50 0.06
51 0.06
52 0.06
53 0.07
54 0.1
55 0.11
56 0.12
57 0.14
58 0.13
59 0.18
60 0.21
61 0.22
62 0.24
63 0.32
64 0.39
65 0.43
66 0.51
67 0.55
68 0.58
69 0.61
70 0.63
71 0.64
72 0.66
73 0.68
74 0.7
75 0.7
76 0.74
77 0.79
78 0.83
79 0.79
80 0.81
81 0.82
82 0.82
83 0.85
84 0.85
85 0.85