Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AV76

Protein Details
Accession G3AV76    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-79RQAREKQKLFEEKRRKAREEBasic
NLS Segment(s)
PositionSequence
64-76EKQKLFEEKRRKA
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
KEGG spaa:SPAPADRAFT_57388  -  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPQLDKNRFDTCEKLMDALEKCHQQEYLKQILGMCNYEKDQLANCLHYTRVEDSKDRIRQAREKQKLFEEKRRKAREEEYGKDGYLQKVIDAELQKKQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.29
4 0.31
5 0.29
6 0.29
7 0.3
8 0.28
9 0.28
10 0.28
11 0.29
12 0.24
13 0.28
14 0.3
15 0.33
16 0.29
17 0.29
18 0.28
19 0.29
20 0.29
21 0.26
22 0.21
23 0.15
24 0.15
25 0.16
26 0.15
27 0.13
28 0.13
29 0.16
30 0.16
31 0.16
32 0.16
33 0.15
34 0.15
35 0.15
36 0.16
37 0.13
38 0.16
39 0.17
40 0.18
41 0.21
42 0.29
43 0.33
44 0.34
45 0.35
46 0.36
47 0.43
48 0.52
49 0.59
50 0.6
51 0.59
52 0.6
53 0.64
54 0.69
55 0.68
56 0.68
57 0.68
58 0.69
59 0.76
60 0.8
61 0.76
62 0.71
63 0.71
64 0.7
65 0.69
66 0.64
67 0.59
68 0.54
69 0.5
70 0.48
71 0.45
72 0.36
73 0.3
74 0.25
75 0.2
76 0.19
77 0.19
78 0.21
79 0.23
80 0.25