Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FZR3

Protein Details
Accession I2FZR3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
155-181WWLASLAQKDKRHRKKHKSKAAAASCTHydrophilic
NLS Segment(s)
PositionSequence
163-175KDKRHRKKHKSKA
423-440KAKRVGGRREEGGSGRRR
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013882  Ctp1_C  
IPR033316  RBBP8-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF08573  SAE2  
Amino Acid Sequences MASPPKRKRDAYASPSSSSVSPASTHHPSTSTPRRPFAPIFEDSLPSPQPMNPSGSMSSDTRQQLELSLSELRTSAARIKSLLQTLPPTSRSALTEVAAPPQNSSLTSSHSGGEEVVKEVTCSKCHQLQEKVQELEQERVRHEKERQAWKEFKSWWLASLAQKDKRHRKKHKSKAAAASCTAASSSTEGAIEGGSRVEEERRSAVVKKLDATTRGVWVRAGIIPPDNAVGGEAERAQGEEKASAGPRRVDQGEQGDMGESAGQQSEVTLPLHAHPPSNAAVATASTPTTTAPTAAAPSASAQPHTRNDKLSPLIRTIIPRPTTLPRAQPVPPTTNTTRDEVGYVDSTPIRNPLQRRAMLAHDCPDCSLFYSHLNTNGEGLGNRERTACSRHRTTFQRATTPDGYWNIGFPTTQEVEEINASAKAKRVGGRREEGGSGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.62
3 0.57
4 0.47
5 0.39
6 0.31
7 0.22
8 0.18
9 0.18
10 0.24
11 0.27
12 0.29
13 0.28
14 0.29
15 0.3
16 0.39
17 0.47
18 0.51
19 0.52
20 0.54
21 0.55
22 0.6
23 0.6
24 0.58
25 0.53
26 0.46
27 0.45
28 0.43
29 0.42
30 0.36
31 0.38
32 0.31
33 0.26
34 0.24
35 0.2
36 0.23
37 0.23
38 0.27
39 0.24
40 0.27
41 0.27
42 0.27
43 0.29
44 0.26
45 0.25
46 0.28
47 0.28
48 0.26
49 0.26
50 0.24
51 0.23
52 0.23
53 0.22
54 0.18
55 0.2
56 0.18
57 0.18
58 0.17
59 0.16
60 0.14
61 0.16
62 0.19
63 0.18
64 0.19
65 0.2
66 0.24
67 0.28
68 0.31
69 0.3
70 0.26
71 0.28
72 0.3
73 0.34
74 0.32
75 0.29
76 0.27
77 0.27
78 0.26
79 0.25
80 0.23
81 0.19
82 0.22
83 0.2
84 0.24
85 0.26
86 0.24
87 0.22
88 0.22
89 0.22
90 0.18
91 0.21
92 0.17
93 0.18
94 0.21
95 0.21
96 0.2
97 0.2
98 0.2
99 0.16
100 0.17
101 0.13
102 0.11
103 0.11
104 0.1
105 0.1
106 0.14
107 0.15
108 0.15
109 0.18
110 0.21
111 0.26
112 0.3
113 0.37
114 0.41
115 0.47
116 0.53
117 0.58
118 0.55
119 0.5
120 0.51
121 0.46
122 0.44
123 0.41
124 0.35
125 0.29
126 0.34
127 0.36
128 0.36
129 0.38
130 0.4
131 0.44
132 0.52
133 0.56
134 0.58
135 0.62
136 0.59
137 0.62
138 0.56
139 0.51
140 0.47
141 0.41
142 0.35
143 0.31
144 0.32
145 0.28
146 0.35
147 0.39
148 0.39
149 0.45
150 0.52
151 0.61
152 0.68
153 0.75
154 0.77
155 0.82
156 0.86
157 0.91
158 0.93
159 0.92
160 0.9
161 0.89
162 0.86
163 0.78
164 0.68
165 0.58
166 0.47
167 0.37
168 0.29
169 0.18
170 0.11
171 0.08
172 0.08
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.05
179 0.04
180 0.04
181 0.03
182 0.04
183 0.04
184 0.06
185 0.06
186 0.08
187 0.09
188 0.1
189 0.12
190 0.14
191 0.18
192 0.2
193 0.21
194 0.21
195 0.23
196 0.23
197 0.23
198 0.25
199 0.21
200 0.22
201 0.22
202 0.2
203 0.17
204 0.16
205 0.15
206 0.13
207 0.12
208 0.08
209 0.09
210 0.08
211 0.09
212 0.09
213 0.07
214 0.06
215 0.06
216 0.05
217 0.04
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.06
225 0.07
226 0.06
227 0.07
228 0.08
229 0.1
230 0.12
231 0.13
232 0.14
233 0.14
234 0.18
235 0.18
236 0.17
237 0.19
238 0.21
239 0.2
240 0.19
241 0.18
242 0.15
243 0.13
244 0.12
245 0.09
246 0.06
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.05
253 0.06
254 0.06
255 0.06
256 0.07
257 0.08
258 0.12
259 0.13
260 0.13
261 0.11
262 0.14
263 0.14
264 0.15
265 0.14
266 0.1
267 0.1
268 0.09
269 0.1
270 0.08
271 0.07
272 0.06
273 0.06
274 0.06
275 0.08
276 0.07
277 0.07
278 0.07
279 0.08
280 0.09
281 0.09
282 0.09
283 0.07
284 0.09
285 0.12
286 0.12
287 0.13
288 0.14
289 0.19
290 0.25
291 0.32
292 0.33
293 0.32
294 0.33
295 0.38
296 0.41
297 0.42
298 0.38
299 0.34
300 0.34
301 0.33
302 0.35
303 0.32
304 0.35
305 0.31
306 0.3
307 0.31
308 0.34
309 0.38
310 0.39
311 0.41
312 0.36
313 0.39
314 0.4
315 0.44
316 0.43
317 0.42
318 0.41
319 0.42
320 0.42
321 0.45
322 0.45
323 0.4
324 0.36
325 0.31
326 0.3
327 0.23
328 0.23
329 0.17
330 0.15
331 0.15
332 0.15
333 0.15
334 0.15
335 0.18
336 0.18
337 0.22
338 0.25
339 0.33
340 0.4
341 0.41
342 0.44
343 0.44
344 0.48
345 0.49
346 0.48
347 0.45
348 0.38
349 0.37
350 0.34
351 0.31
352 0.25
353 0.22
354 0.2
355 0.15
356 0.18
357 0.21
358 0.22
359 0.28
360 0.29
361 0.27
362 0.27
363 0.26
364 0.23
365 0.18
366 0.2
367 0.21
368 0.21
369 0.21
370 0.22
371 0.23
372 0.25
373 0.32
374 0.36
375 0.37
376 0.44
377 0.49
378 0.56
379 0.61
380 0.68
381 0.7
382 0.68
383 0.7
384 0.63
385 0.66
386 0.61
387 0.55
388 0.51
389 0.44
390 0.42
391 0.33
392 0.32
393 0.26
394 0.23
395 0.21
396 0.16
397 0.2
398 0.18
399 0.18
400 0.18
401 0.16
402 0.18
403 0.19
404 0.19
405 0.14
406 0.15
407 0.16
408 0.16
409 0.2
410 0.21
411 0.24
412 0.3
413 0.37
414 0.43
415 0.5
416 0.56
417 0.56
418 0.56
419 0.56
420 0.56