Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3ARE5

Protein Details
Accession G3ARE5    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
305-327EAKTAKSEKKTGTKKRTVKVEITHydrophilic
NLS Segment(s)
PositionSequence
302-321KKFEAKTAKSEKKTGTKKRT
Subcellular Location(s) cyto 19.5, cyto_nucl 13.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001719  AP_endonuc_2  
IPR018246  AP_endonuc_F2_Zn_BS  
IPR036237  Xyl_isomerase-like_sf  
IPR013022  Xyl_isomerase-like_TIM-brl  
Gene Ontology GO:0003677  F:DNA binding  
GO:0016787  F:hydrolase activity  
GO:0008270  F:zinc ion binding  
GO:0006281  P:DNA repair  
KEGG spaa:SPAPADRAFT_140201  -  
Pfam View protein in Pfam  
PF01261  AP_endonuc_2  
PROSITE View protein in PROSITE  
PS00729  AP_NUCLEASE_F2_1  
PS00730  AP_NUCLEASE_F2_2  
PS00731  AP_NUCLEASE_F2_3  
PS51432  AP_NUCLEASE_F2_4  
CDD cd00019  AP2Ec  
Amino Acid Sequences MSGGISKAVTNAMDIGANSFALFLKSPRKWVSPDIPDAEAEKFAELCKKYGYNPRTDILPHGSYFINLGNPDPEKEEKAYGSFLDDLKRCEKLNIGLYNFHPGSSLDSDHGEALERLAKNINKAIKETEFVKIVIENMAGHGNLIGSNLQDIRDVIDMVEDKSRVGVCLDTCHSFAAGYDISDEEKFNAFLKQFDDIIGAEYLSAIHLNDSKAPLGANRDLHQKLGYGFLGLEVFRVIANCDRLKTIPIILETPVGNDDSVYGEEIKLLEWLEGRSIDDGEFVAKTEELSKLGSKERDEHLKKFEAKTAKSEKKTGTKKRTVKVEITTMVSKKTKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.11
4 0.11
5 0.1
6 0.09
7 0.09
8 0.09
9 0.1
10 0.11
11 0.21
12 0.23
13 0.3
14 0.35
15 0.39
16 0.41
17 0.49
18 0.55
19 0.53
20 0.59
21 0.55
22 0.52
23 0.48
24 0.47
25 0.4
26 0.31
27 0.24
28 0.18
29 0.14
30 0.14
31 0.2
32 0.19
33 0.19
34 0.22
35 0.23
36 0.28
37 0.38
38 0.42
39 0.43
40 0.45
41 0.45
42 0.44
43 0.43
44 0.42
45 0.39
46 0.37
47 0.29
48 0.27
49 0.26
50 0.23
51 0.23
52 0.2
53 0.16
54 0.13
55 0.13
56 0.15
57 0.16
58 0.17
59 0.2
60 0.21
61 0.21
62 0.23
63 0.24
64 0.21
65 0.22
66 0.22
67 0.18
68 0.19
69 0.18
70 0.17
71 0.21
72 0.21
73 0.23
74 0.24
75 0.27
76 0.25
77 0.23
78 0.25
79 0.24
80 0.31
81 0.33
82 0.33
83 0.33
84 0.34
85 0.4
86 0.37
87 0.32
88 0.24
89 0.19
90 0.21
91 0.2
92 0.2
93 0.14
94 0.15
95 0.15
96 0.15
97 0.14
98 0.11
99 0.09
100 0.08
101 0.13
102 0.11
103 0.12
104 0.16
105 0.17
106 0.18
107 0.23
108 0.26
109 0.22
110 0.24
111 0.27
112 0.23
113 0.25
114 0.25
115 0.22
116 0.2
117 0.19
118 0.18
119 0.14
120 0.13
121 0.12
122 0.1
123 0.07
124 0.07
125 0.08
126 0.07
127 0.06
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.04
134 0.05
135 0.05
136 0.05
137 0.06
138 0.06
139 0.07
140 0.07
141 0.07
142 0.06
143 0.07
144 0.08
145 0.08
146 0.1
147 0.08
148 0.08
149 0.09
150 0.09
151 0.08
152 0.08
153 0.08
154 0.06
155 0.09
156 0.11
157 0.12
158 0.12
159 0.12
160 0.11
161 0.1
162 0.1
163 0.1
164 0.08
165 0.06
166 0.07
167 0.07
168 0.08
169 0.08
170 0.09
171 0.07
172 0.08
173 0.08
174 0.08
175 0.1
176 0.1
177 0.11
178 0.12
179 0.12
180 0.12
181 0.12
182 0.12
183 0.1
184 0.11
185 0.1
186 0.09
187 0.06
188 0.06
189 0.06
190 0.05
191 0.05
192 0.03
193 0.04
194 0.06
195 0.07
196 0.08
197 0.1
198 0.1
199 0.1
200 0.1
201 0.11
202 0.14
203 0.17
204 0.18
205 0.19
206 0.26
207 0.26
208 0.27
209 0.26
210 0.23
211 0.19
212 0.2
213 0.18
214 0.11
215 0.11
216 0.1
217 0.11
218 0.09
219 0.09
220 0.06
221 0.06
222 0.05
223 0.06
224 0.07
225 0.09
226 0.14
227 0.15
228 0.16
229 0.17
230 0.18
231 0.2
232 0.2
233 0.19
234 0.17
235 0.18
236 0.18
237 0.17
238 0.19
239 0.17
240 0.16
241 0.15
242 0.13
243 0.11
244 0.09
245 0.09
246 0.09
247 0.09
248 0.09
249 0.09
250 0.08
251 0.09
252 0.09
253 0.09
254 0.08
255 0.08
256 0.08
257 0.08
258 0.09
259 0.1
260 0.11
261 0.11
262 0.11
263 0.12
264 0.11
265 0.1
266 0.1
267 0.1
268 0.09
269 0.09
270 0.09
271 0.08
272 0.09
273 0.1
274 0.12
275 0.11
276 0.14
277 0.16
278 0.18
279 0.24
280 0.28
281 0.28
282 0.32
283 0.37
284 0.46
285 0.49
286 0.51
287 0.52
288 0.56
289 0.6
290 0.57
291 0.59
292 0.56
293 0.53
294 0.58
295 0.62
296 0.63
297 0.62
298 0.66
299 0.67
300 0.69
301 0.77
302 0.78
303 0.78
304 0.79
305 0.83
306 0.84
307 0.87
308 0.83
309 0.8
310 0.75
311 0.73
312 0.66
313 0.63
314 0.61
315 0.52
316 0.52
317 0.49