Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3APN1

Protein Details
Accession G3APN1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-26LDAKSLSKTKRKNPSLKPEYLIHydrophilic
49-75RFRSKDGCLNCRKRRKKCDETMPICYAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG spaa:SPAPADRAFT_61284  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MFSVLDAKSLSKTKRKNPSLKPEYLIAAKDEKNGFEQKPIKLNNIVKTRFRSKDGCLNCRKRRKKCDETMPICYACQYRHLECTWPKHVQERMSESPSVDSTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.75
4 0.79
5 0.85
6 0.84
7 0.81
8 0.74
9 0.65
10 0.59
11 0.51
12 0.42
13 0.33
14 0.29
15 0.25
16 0.27
17 0.25
18 0.22
19 0.24
20 0.27
21 0.26
22 0.29
23 0.33
24 0.3
25 0.37
26 0.38
27 0.37
28 0.39
29 0.43
30 0.43
31 0.47
32 0.47
33 0.43
34 0.47
35 0.51
36 0.46
37 0.46
38 0.41
39 0.36
40 0.41
41 0.44
42 0.47
43 0.5
44 0.57
45 0.63
46 0.71
47 0.78
48 0.79
49 0.84
50 0.86
51 0.86
52 0.86
53 0.88
54 0.88
55 0.84
56 0.82
57 0.75
58 0.65
59 0.55
60 0.48
61 0.38
62 0.28
63 0.28
64 0.26
65 0.24
66 0.27
67 0.28
68 0.34
69 0.38
70 0.45
71 0.46
72 0.46
73 0.46
74 0.5
75 0.54
76 0.51
77 0.53
78 0.54
79 0.54
80 0.52
81 0.52
82 0.45
83 0.43