Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FYR6

Protein Details
Accession I2FYR6   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
106-127LKKALRGKAKARKEARRARENMBasic
NLS Segment(s)
PositionSequence
8-26LKVARKAAAAPPTPPKRKK
68-124KKREDAQRRKEKSTLQPGAKGGGALAGKVKSKAEIKMELKKALRGKAKARKEARRAR
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
Amino Acid Sequences MAASAKPLKVARKAAAAPPTPPKRKKFAEDSGLSHLLSLTESIVSAKTESQTKQIQQKKSQVAAIQQKKREDAQRRKEKSTLQPGAKGGGALAGKVKSKAEIKMELKKALRGKAKARKEARRARENMVDGAVQAETVGEKGKGQGQKGARKSVSFAFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.52
3 0.48
4 0.46
5 0.5
6 0.57
7 0.59
8 0.64
9 0.63
10 0.64
11 0.68
12 0.71
13 0.7
14 0.69
15 0.69
16 0.66
17 0.65
18 0.63
19 0.58
20 0.5
21 0.41
22 0.32
23 0.22
24 0.18
25 0.14
26 0.07
27 0.05
28 0.05
29 0.06
30 0.06
31 0.07
32 0.07
33 0.08
34 0.09
35 0.13
36 0.14
37 0.18
38 0.23
39 0.27
40 0.35
41 0.42
42 0.47
43 0.5
44 0.58
45 0.59
46 0.56
47 0.54
48 0.47
49 0.47
50 0.5
51 0.53
52 0.5
53 0.49
54 0.48
55 0.47
56 0.49
57 0.5
58 0.51
59 0.52
60 0.57
61 0.63
62 0.67
63 0.69
64 0.68
65 0.66
66 0.64
67 0.64
68 0.6
69 0.51
70 0.49
71 0.46
72 0.44
73 0.38
74 0.29
75 0.18
76 0.14
77 0.12
78 0.09
79 0.1
80 0.1
81 0.1
82 0.11
83 0.12
84 0.11
85 0.14
86 0.17
87 0.19
88 0.27
89 0.31
90 0.39
91 0.42
92 0.45
93 0.43
94 0.46
95 0.47
96 0.45
97 0.48
98 0.45
99 0.51
100 0.55
101 0.63
102 0.67
103 0.72
104 0.74
105 0.77
106 0.82
107 0.82
108 0.82
109 0.77
110 0.74
111 0.73
112 0.65
113 0.57
114 0.49
115 0.39
116 0.29
117 0.26
118 0.2
119 0.12
120 0.09
121 0.07
122 0.05
123 0.05
124 0.07
125 0.06
126 0.07
127 0.09
128 0.15
129 0.19
130 0.21
131 0.27
132 0.34
133 0.44
134 0.49
135 0.57
136 0.53
137 0.5
138 0.52