Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FVG0

Protein Details
Accession I2FVG0   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
199-218LSAGRPKKSKRVHLRPEDSHBasic
NLS Segment(s)
PositionSequence
205-207KKS
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023468  Riboflavin_kinase  
IPR015865  Riboflavin_kinase_bac/euk  
IPR023465  Riboflavin_kinase_dom_sf  
Gene Ontology GO:0005524  F:ATP binding  
GO:0008531  F:riboflavin kinase activity  
GO:0009398  P:FMN biosynthetic process  
GO:0016310  P:phosphorylation  
GO:0009231  P:riboflavin biosynthetic process  
Pfam View protein in Pfam  
PF01687  Flavokinase  
Amino Acid Sequences MSVSTSEQAVKSPANPNSRPEVCGPHAPERPYPIYLRGKVEKGFGRGSKDLGCPTANLPSKVVGPGSPLTRTGVYFGFARVLPQDPDDPTLTDSEDVDADYAAQNPVAADSLDDEDNEVVLGASPIRDLDEAFADSGLPRPRQASRALPSPASVLEADSRRPHKEAQLSRSELRNGARDPPTGSLHGATASSSSSSSSLSAGRPKKSKRVHLRPEDSHVFPMVMSVGWNPFYKNTHKTAEVHILHEFGADFYDHEIRVVVLGYVRPEYNYESMDALIADIEMDKKVTVNSLNRPLYQDYSQDPFLGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.46
4 0.52
5 0.53
6 0.51
7 0.46
8 0.47
9 0.42
10 0.48
11 0.5
12 0.49
13 0.53
14 0.53
15 0.53
16 0.53
17 0.52
18 0.47
19 0.44
20 0.44
21 0.47
22 0.48
23 0.52
24 0.5
25 0.5
26 0.49
27 0.53
28 0.49
29 0.44
30 0.47
31 0.43
32 0.44
33 0.41
34 0.42
35 0.4
36 0.38
37 0.36
38 0.32
39 0.29
40 0.24
41 0.24
42 0.3
43 0.3
44 0.28
45 0.27
46 0.26
47 0.26
48 0.26
49 0.25
50 0.16
51 0.16
52 0.18
53 0.19
54 0.19
55 0.18
56 0.19
57 0.2
58 0.2
59 0.18
60 0.16
61 0.15
62 0.14
63 0.14
64 0.13
65 0.12
66 0.13
67 0.12
68 0.14
69 0.13
70 0.15
71 0.17
72 0.16
73 0.19
74 0.19
75 0.18
76 0.17
77 0.17
78 0.16
79 0.14
80 0.12
81 0.1
82 0.09
83 0.08
84 0.07
85 0.06
86 0.06
87 0.06
88 0.07
89 0.06
90 0.05
91 0.05
92 0.05
93 0.06
94 0.06
95 0.05
96 0.04
97 0.05
98 0.07
99 0.08
100 0.07
101 0.08
102 0.07
103 0.07
104 0.07
105 0.05
106 0.03
107 0.03
108 0.04
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.04
116 0.05
117 0.06
118 0.07
119 0.07
120 0.07
121 0.06
122 0.06
123 0.1
124 0.13
125 0.12
126 0.12
127 0.14
128 0.16
129 0.18
130 0.22
131 0.25
132 0.25
133 0.31
134 0.32
135 0.3
136 0.29
137 0.27
138 0.24
139 0.18
140 0.15
141 0.09
142 0.1
143 0.11
144 0.12
145 0.16
146 0.18
147 0.19
148 0.2
149 0.21
150 0.23
151 0.31
152 0.36
153 0.37
154 0.43
155 0.45
156 0.45
157 0.47
158 0.43
159 0.36
160 0.32
161 0.31
162 0.24
163 0.26
164 0.27
165 0.25
166 0.26
167 0.26
168 0.26
169 0.23
170 0.22
171 0.17
172 0.15
173 0.14
174 0.12
175 0.09
176 0.07
177 0.06
178 0.06
179 0.06
180 0.06
181 0.06
182 0.07
183 0.07
184 0.08
185 0.09
186 0.11
187 0.19
188 0.23
189 0.28
190 0.35
191 0.38
192 0.47
193 0.53
194 0.62
195 0.65
196 0.71
197 0.77
198 0.8
199 0.85
200 0.79
201 0.79
202 0.74
203 0.64
204 0.55
205 0.45
206 0.34
207 0.25
208 0.21
209 0.14
210 0.09
211 0.07
212 0.07
213 0.08
214 0.1
215 0.1
216 0.11
217 0.13
218 0.17
219 0.22
220 0.26
221 0.3
222 0.32
223 0.35
224 0.36
225 0.39
226 0.46
227 0.42
228 0.39
229 0.35
230 0.31
231 0.28
232 0.26
233 0.21
234 0.11
235 0.1
236 0.07
237 0.07
238 0.09
239 0.12
240 0.11
241 0.11
242 0.11
243 0.1
244 0.11
245 0.11
246 0.08
247 0.07
248 0.09
249 0.1
250 0.12
251 0.12
252 0.13
253 0.14
254 0.18
255 0.19
256 0.19
257 0.19
258 0.18
259 0.17
260 0.17
261 0.15
262 0.11
263 0.08
264 0.07
265 0.06
266 0.05
267 0.06
268 0.06
269 0.07
270 0.07
271 0.08
272 0.08
273 0.11
274 0.17
275 0.23
276 0.31
277 0.4
278 0.44
279 0.45
280 0.49
281 0.5
282 0.49
283 0.45
284 0.41
285 0.36
286 0.37
287 0.37