Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FW82

Protein Details
Accession I2FW82    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-99SKRYLKYLTKKHLRKQQLRDWLRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, mito 8, pero 6, mito_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAVTKTTKAAKQSKTSHKFFIDFSGPANDGILDAAAFEKYLHDRIKVDGKAGNLGDHVKITREGEGKIWVDTNVAFSKRYLKYLTKKHLRKQQLRDWLRVVATSKQGYEIKFFNVSYDQDEAEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.73
3 0.72
4 0.67
5 0.62
6 0.53
7 0.5
8 0.43
9 0.34
10 0.32
11 0.3
12 0.26
13 0.24
14 0.23
15 0.16
16 0.12
17 0.12
18 0.09
19 0.05
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.06
26 0.07
27 0.12
28 0.13
29 0.14
30 0.15
31 0.18
32 0.26
33 0.25
34 0.25
35 0.23
36 0.22
37 0.24
38 0.24
39 0.21
40 0.14
41 0.14
42 0.13
43 0.11
44 0.11
45 0.08
46 0.09
47 0.09
48 0.12
49 0.12
50 0.12
51 0.13
52 0.16
53 0.16
54 0.15
55 0.15
56 0.12
57 0.11
58 0.11
59 0.13
60 0.12
61 0.12
62 0.12
63 0.12
64 0.2
65 0.2
66 0.23
67 0.24
68 0.29
69 0.37
70 0.46
71 0.56
72 0.59
73 0.65
74 0.71
75 0.77
76 0.8
77 0.81
78 0.81
79 0.8
80 0.8
81 0.77
82 0.74
83 0.67
84 0.6
85 0.51
86 0.44
87 0.38
88 0.32
89 0.33
90 0.3
91 0.27
92 0.29
93 0.32
94 0.3
95 0.31
96 0.28
97 0.26
98 0.28
99 0.27
100 0.25
101 0.25
102 0.26
103 0.26
104 0.26