Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2G539

Protein Details
Accession I2G539    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
17-40EPNAPPTRRSSRLRRKTRELIDFPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.833, cyto 6, cyto_mito 4.833, mito 2.5
Family & Domain DBs
Amino Acid Sequences MPYSSVPIVSPSTLNVEPNAPPTRRSSRLRRKTRELIDFPHIDDAELRHAVDAIDQAHQDYIDALDVLGPDATEAQHVRTYAILALKWDVRNSFDFSTTTASATIEFLIADALSHAEPLSQESCLAWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.19
4 0.19
5 0.25
6 0.3
7 0.25
8 0.26
9 0.32
10 0.39
11 0.44
12 0.5
13 0.55
14 0.6
15 0.7
16 0.79
17 0.8
18 0.82
19 0.84
20 0.85
21 0.84
22 0.77
23 0.72
24 0.67
25 0.6
26 0.51
27 0.46
28 0.38
29 0.28
30 0.24
31 0.2
32 0.17
33 0.16
34 0.15
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1
40 0.07
41 0.07
42 0.07
43 0.08
44 0.08
45 0.07
46 0.07
47 0.06
48 0.05
49 0.04
50 0.04
51 0.03
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.04
60 0.05
61 0.05
62 0.06
63 0.08
64 0.08
65 0.09
66 0.09
67 0.09
68 0.1
69 0.11
70 0.1
71 0.09
72 0.11
73 0.14
74 0.15
75 0.16
76 0.15
77 0.16
78 0.18
79 0.22
80 0.22
81 0.2
82 0.19
83 0.2
84 0.24
85 0.22
86 0.2
87 0.16
88 0.15
89 0.13
90 0.14
91 0.12
92 0.07
93 0.07
94 0.06
95 0.06
96 0.05
97 0.05
98 0.04
99 0.06
100 0.05
101 0.06
102 0.06
103 0.06
104 0.07
105 0.11
106 0.12
107 0.11
108 0.11