Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FNI7

Protein Details
Accession I2FNI7   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-29ASTSKAKGGRRGKRAQPQADNHydrophilic
NLS Segment(s)
PositionSequence
14-22AKGGRRGKR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.833, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MAEETGTQASTSKAKGGRRGKRAQPQADNEAINKTEVEVLNDNTNKGTDSDSDLDGDSKQYNFHTLAKLLEPVPKLTSHNYYSWSAHIKSFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.36
3 0.45
4 0.53
5 0.59
6 0.67
7 0.71
8 0.76
9 0.81
10 0.8
11 0.78
12 0.75
13 0.71
14 0.66
15 0.58
16 0.49
17 0.42
18 0.33
19 0.26
20 0.19
21 0.14
22 0.14
23 0.13
24 0.15
25 0.14
26 0.15
27 0.19
28 0.2
29 0.2
30 0.16
31 0.16
32 0.13
33 0.12
34 0.12
35 0.07
36 0.11
37 0.12
38 0.13
39 0.13
40 0.13
41 0.13
42 0.12
43 0.13
44 0.1
45 0.08
46 0.09
47 0.09
48 0.11
49 0.13
50 0.15
51 0.16
52 0.16
53 0.18
54 0.18
55 0.2
56 0.18
57 0.21
58 0.2
59 0.2
60 0.2
61 0.2
62 0.22
63 0.24
64 0.29
65 0.28
66 0.29
67 0.31
68 0.33
69 0.33
70 0.35
71 0.37
72 0.32