Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6R878

Protein Details
Accession A0A2J6R878    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKRNKKTSQTKFKVRCSRHHydrophilic
NLS Segment(s)
PositionSequence
77-78KG
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEISDIKNFIEICRRKDASSARIKRNKKTSQTKFKVRCSRHLYTLVLKDSEKVEKLKQSLPPSLTIADTPKKNAKGKRTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.4
3 0.41
4 0.37
5 0.44
6 0.49
7 0.48
8 0.54
9 0.58
10 0.59
11 0.67
12 0.71
13 0.72
14 0.76
15 0.76
16 0.75
17 0.77
18 0.78
19 0.8
20 0.83
21 0.86
22 0.83
23 0.84
24 0.84
25 0.76
26 0.75
27 0.71
28 0.66
29 0.6
30 0.57
31 0.49
32 0.44
33 0.46
34 0.38
35 0.32
36 0.28
37 0.25
38 0.23
39 0.24
40 0.21
41 0.19
42 0.2
43 0.24
44 0.27
45 0.31
46 0.36
47 0.38
48 0.42
49 0.41
50 0.4
51 0.38
52 0.36
53 0.32
54 0.27
55 0.27
56 0.28
57 0.28
58 0.31
59 0.37
60 0.43
61 0.5
62 0.56