Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RV55

Protein Details
Accession A0A2J6RV55    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MRSLMAKTRQPPKQPKKQQPKKQKAKSLKDILRQLGHydrophilic
NLS Segment(s)
PositionSequence
9-27RQPPKQPKKQQPKKQKAKS
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029526  PGBD  
Pfam View protein in Pfam  
PF13843  DDE_Tnp_1_7  
Amino Acid Sequences MRSLMAKTRQPPKQPKKQQPKKQKAKSLKDILRQLGPIANVSYQPFKPESKRPAQALLPTSFPRNAHPFDYFSLFFTHDLFRTITTNTNQYAGIQQIHVPQERVRGWTNLLVEELYVFIGSIIYMGVHEEPQAKIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.9
4 0.94
5 0.94
6 0.94
7 0.95
8 0.95
9 0.94
10 0.94
11 0.93
12 0.92
13 0.92
14 0.91
15 0.87
16 0.84
17 0.81
18 0.73
19 0.65
20 0.56
21 0.46
22 0.38
23 0.31
24 0.24
25 0.18
26 0.15
27 0.13
28 0.15
29 0.18
30 0.15
31 0.17
32 0.18
33 0.2
34 0.24
35 0.31
36 0.37
37 0.41
38 0.46
39 0.45
40 0.47
41 0.46
42 0.46
43 0.42
44 0.36
45 0.31
46 0.27
47 0.27
48 0.25
49 0.23
50 0.21
51 0.21
52 0.22
53 0.21
54 0.22
55 0.22
56 0.21
57 0.24
58 0.21
59 0.18
60 0.17
61 0.16
62 0.14
63 0.14
64 0.14
65 0.11
66 0.12
67 0.12
68 0.11
69 0.11
70 0.12
71 0.15
72 0.15
73 0.18
74 0.17
75 0.18
76 0.17
77 0.16
78 0.17
79 0.14
80 0.14
81 0.11
82 0.12
83 0.15
84 0.19
85 0.19
86 0.19
87 0.18
88 0.25
89 0.26
90 0.28
91 0.26
92 0.25
93 0.26
94 0.29
95 0.29
96 0.23
97 0.22
98 0.18
99 0.15
100 0.14
101 0.12
102 0.08
103 0.06
104 0.05
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.03
111 0.03
112 0.05
113 0.06
114 0.07
115 0.09
116 0.11